PRGDB00066055 (At.22486)

From PRG Wiki
Jump to: navigation, search
At.22486
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145353528 (NM_119712)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat family protein (AT4G35470) mRNA, complete cds

DNA Sequence

agaagaagaagaagagaaaattttgacagagataatacacagatagagagaagagacagagacagagagTGATGGAAACAGCTGTATTTATTATGAGACGAAACAAGAACCTCTGGGTTTCTACTTAAACTCTTCTCTCTTTCCTCTCTCACTTTAAAAATCCACACTTTAGAGCACACAATACAAAAAATAAGGGTTTCTTTATCTTTTCGTTTCTTCCAAATTTTGTAATGGATTTGATGCAAATGGATAAGCGTTTGGATTCAACGGAGCAAGTGGTTGAAGAAATCATGAGAATTCACAGATCTCTACCCGCAAGACCAGGAATTGACGAAGTTGAAGCTGCCAAGGGTTTGATTGACAACGTTGAGAAAGAAGATCAAGCTTGTTTAGAAGCCATTGCTAGACAGAGGAAAAGCTCTGAAGTTCCTGGTGAGCTTTTCATGGTGTTGCAAGAAATGAAGAAGGGTTATGTTCAGTTTCGTAGCAAAGAACAGATAAGAGAAGCTTTGAAGCTTCTCGATCTGGAATCTGTTCACTCTTTGTTCGATGATTTCATTCAAAGAGCTTCTAATTGCATTGCTTCTCCTTCCTCTAACGGCTCTGTTTCGTCTCGTCCTCCGCTGCCTCCGGCGACTACGACGGCTGCTCGTTCTGATTCTCAGTCAAGTTTGAATTTTTCTGAGAGAGCTCCCGTTCGCCCCAAGGATATGGTTTCGCGAGACGATAGCTTCGTCACAAAGTCTAAGCCTTCTTCTCTCTACAGTGATGGTTTTGCAGCTCCTCCTCGAAGACCACAGATTCTCGATTCAACACTTACCACCGGCAATGATGGAGAGAAGCTGAGTTTGATAAAACTTGCTAGTTTGATTGAGGTATCAGCTAAGAAAGCTACACAAGAGATAAATCTACAGAACAAGTTAACGGAACAACTCGAGTGGCTTCCAGATTCTCTTGGCAAGTTATCGAGTTTAACTTCGCTTGATTTGTCTGAGAATCACATTGTGGTGTTGCCAAACACTATAGGAGGACTTTCTTCCTTGACAAAACTCGATTTGCATTCCAACAGAATCGGTCAGCTTCCTGAGTCTATAGGAGAATTGTTGAACTTGGTTTACCTCAATCTTGGTAGCAACCAGTTATCATCTCTGCCTTCAGCGTTTAGTAGATTGGTTCGACTCGAGGAGCTTGATTTGAGCTGTAACAACCTCCCGATTCTCCCTGAATCCATAGGTTCGCTTGTGAGTCTAAAGAAGCTCGACGTTGAGACAAATGATATCGAAGAGATCCCATATTCTATTGGTGGATGTTCTTCTCTGATAGAACTCCGTGCAGATTATAACAAACTAAAGGCTCTTCCAGAAGCTATTGGGAAGATTACTACATTAGAGATCTTGTCTGTGCGTTACAATAACATCAGGCAGTTACCTACGACGATGTCTTCTTTAGCTAGCCTCAAAGAGCTGGATGTGAGTTTCAACGAGCTCGAGTCAGTGCCAGAGAGTTTGTGTTTTGCCACTACACTTGTGAAACTGAATATTGGAAACAATTTCGCTGACATGGTATCGCTCCCGAGATCAATAGGCAACCTTGAGATGCTTGAAGAGCTTGATATAAGCAATAATCAGATCCGTGTTCTACCTGACTCCTTCAAAATGCTTACAAAGTTGCGTGTGTTTCGTGCTCAGGAGAATCCACTACACATTCCTCCTCGTGATATAGCTGAAAAGGGCCCTCAGGCCGTTGTTCAATACATGAATGATCTTGTGGAGACGAGAAACGCGAAATCTCTAATGGTTAAGCCAAAGAAGAGCTGGGTCCAGATGTGCTTCTTCTCGAAATCCAACAAGAGAAAACAGAGCAGCATGGAGATTGTCTAACACAGCTGATAATGTCTCTGACCCTAAATCAGGTAATTCTGTTAAAGCTGTTGACAGCACAAGTGACAAACATATCCAGCTATCTTCTTCACACGACAATGCATTGATTTGCATTGCAACTCCAAGTACTGTAGATGTTTCACTATTCATTCTTTGTTTGTTTCTTTCTTCACTATTCACATGTATCAATGTGCACAACATTGTTTCATTCATGTCTCTCCACATATCATAGAGCCCATCCCAAAACAGAATCGAACCATGTCCCTTGTAGATTGAGGTTTTCATTAAGCTCTTACCATGTTTGTCTATCGTCTCTGGTTTTGTTTCTTTGGTTTGAAACTTAAGACACTCACATCTGTGTATATGGATAGAGATGTGATGTAAATGTGATGGCTTTGAAGTTTAGAGGAGAGATGTGACATGAGTTGGCTTTGAACGTGGTTTTGTCTAGAGAGTAACTTGGTTAATTAATACTCCCTTGTAATAATGCAACTTCttttttgttttgttttGTCTATGTGTATAATCGTCACGAGACATGGTCTTTCTTTCATGTGTGTTATCATATTATGATACATGTGACTTCACATGTGAACCA


Protein sequences

Name Description Sequence
At.22486 translated coding region predicted by ESTScan from UniGene At.22486

MDKRLDSTEQVVEEIMRIHRSLPARPGIDEVEAAKGLIDNVEKEDQACLEAIARQRKSSEVPGELFMVLQEMKKGYVQFRSKEQIREALKLLDLESVHSLFDDFIQRASNCIASPSSNGSVSSRPPLPPATTTAARSDSQSSLNFSERAPVRPKDMVSRDDSFVTKSKPSSLYSDGFAAPPRRPQILDSTLTTGNDGEKLSLIKLASLIEVSAKKATQEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPRDIAEKGPQAVVQYMNDLVETRNAKSLMVKPKKSWVQMCFFSKSNKRKQSSMEIV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF267
36-492 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GLIDNVEKEDQACLEAIARQRKSSEVPGELFMVLQEMKKGYVQFRSKEQIREALKLLDLESVHSLFDDFIQRASNCIASPSSNGSVSSRPPLPPATTTAARSDSQSSLNFSERAPVRPKDMVSRDDSFVTKSKPSSLYSDGFAAPPRRPQILDSTLTTGNDGEKLSLIKLASLIEVSAKKATQEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPRDI

HMMPanther: PTHR23155
36-492 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GLIDNVEKEDQACLEAIARQRKSSEVPGELFMVLQEMKKGYVQFRSKEQIREALKLLDLESVHSLFDDFIQRASNCIASPSSNGSVSSRPPLPPATTTAARSDSQSSLNFSERAPVRPKDMVSRDDSFVTKSKPSSLYSDGFAAPPRRPQILDSTLTTGNDGEKLSLIKLASLIEVSAKKATQEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPRDI

Seg: seg
114-135 seg

SPSSNGSVSSRPPLPPATTTAA

superfamily: SSF52058
192-495 L domain-like,LRR

TTGNDGEKLSLIKLASLIEVSAKKATQEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPRDIAEK

Gene3D: G3DSA:3.80.10.10
214-359 no description

KKATQEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLI

HMMSmart: SM00364
240-259 Leucine-rich repeats, bacterial type

LSSLTSLDLSENHIVVLPNT

HMMSmart: SM00369
IPR003591
240-262 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLTSLDLSENHIVVLPNTIGG

ProfileScan: PS51450
IPR001611
242-263 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLDLSENHIVVLPNTIGGL

HMMPfam: PF00560
IPR001611
242-263 LRR_1
Leucine-rich repeat

SLTSLDLSENHIVVLPNTIGGL

HMMSmart: SM00364
263-282 Leucine-rich repeats, bacterial type

LSSLTKLDLHSNRIGQLPES

HMMSmart: SM00369
IPR003591
263-284 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLTKLDLHSNRIGQLPESIG

HMMPfam: PF13855
264-322 LRR_8,Leucine rich repeat

SSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSNQLSSLPSAFSRLVRLEELDLSCNNL

ProfileScan: PS51450
IPR001611
265-286 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLDLHSNRIGQLPESIGEL

HMMSmart: SM00364
286-305 Leucine-rich repeats, bacterial type

LLNLVYLNLGSNQLSSLPSA

HMMSmart: SM00369
IPR003591
286-308 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLNLVYLNLGSNQLSSLPSAFSR

ProfileScan: PS51450
IPR001611
288-309 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLNLGSNQLSSLPSAFSRL

HMMSmart: SM00369
IPR003591
309-331 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVRLEELDLSCNNLPILPESIGS

HMMSmart: SM00364
309-328 Leucine-rich repeats, bacterial type

LVRLEELDLSCNNLPILPES

ProfileScan: PS51450
IPR001611
311-332 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLEELDLSCNNLPILPESIGSL

HMMSmart: SM00364
332-351 Leucine-rich repeats, bacterial type

LVSLKKLDVETNDIEEIPYS

HMMSmart: SM00369
IPR003591
332-355 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVSLKKLDVETNDIEEIPYSIGGC

ProfileScan: PS51450
IPR001611
334-355 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKKLDVETNDIEEIPYSIGGC

HMMSmart: SM00364
355-374 Leucine-rich repeats, bacterial type

CSSLIELRADYNKLKALPEA

ProfileScan: PS51450
IPR001611
357-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIELRADYNKLKALPEAIGKI

Gene3D: G3DSA:3.80.10.10
360-490 no description

ELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPR

HMMSmart: SM00369
IPR003591
378-400 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ITTLEILSVRYNNIRQLPTTMSS

HMMPfam: PF12799
379-418 LRR_4,Leucine Rich repeats (2 copies)

TTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVP

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEILSVRYNNIRQLPTTMSSL

HMMSmart: SM00364
380-397 Leucine-rich repeats, bacterial type

TLEILSVRYNNIRQLPTT

HMMSmart: SM00369
IPR003591
401-424 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LASLKELDVSFNELESVPESLCFA

HMMSmart: SM00364
401-420 Leucine-rich repeats, bacterial type

LASLKELDVSFNELESVPES

ProfileScan: PS51450
IPR001611
403-424 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKELDVSFNELESVPESLCFA

HMMSmart: SM00369
IPR003591
449-471 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LEMLEELDISNNQIRVLPDSFKM

HMMSmart: SM00364
449-468 Leucine-rich repeats, bacterial type

LEMLEELDISNNQIRVLPDS

ProfileScan: PS51450
IPR001611
451-472 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLEELDISNNQIRVLPDSFKML

HMMPfam: PF00560
IPR001611
452-470 LRR_1
Leucine-rich repeat

LEELDISNNQIRVLPDSFK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox