PRGDB00066067 (At.22848)

From PRG Wiki
Jump to: navigation, search
At.22848
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358538 (NM_122928)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ATP binding

DNA Sequence

AACACaaaaaaaaaCAAGAACTCATTCAGATTCTTCTCTGATGATCCACTTCTTGTAATAATAACAAAAACAAACAGAGTGGTTTCTCTATGAAATCAACGTTTCtgttgttgttgttgttACTTAGTCTCAATCTTCTCTTTGTCTTTGTTTCATGTGCTTCTTCCATAGAGTTTGTTTACCCTAATTTCACAGCTTCTAACCTCAGATTCGTCGATAGCTCCAAAGGAGCTTTCCTCTTGTCTCGTAATTCCATCTTCAAAGCCGGTTTATTCAGTCCCGGCGGCGATGATTCCTCTACCGGTTTCTACTTCTCCGTCGTCCATGTCGATTCCGGTTCAACAATCTGGTCATCAAATCGAGATTCCCCTGTTTCAAGCTCTGGTACAATGAATCTTACTCCTCAAGGAATCTCTGTTATTGAAGATGGTAAAAGTCAAATACCAGTTTGGTCAACGCCGGTTTTAGCTTCTCCGGTTAAGTCCCTTCGGTTAACCGACGCCGGTAATCTCCTTCTTCTTGATCACTTGAACGTTTCTCTATGGGAAAGCTTTGATTTTCCTACTGACTCGATCGTTCTTGGACAAAGACTTAAGCTTGGGATGTTCTTGTCCGGATCCGTCTCGCGGTCTGATTTCTCTACCGGAGATTATAAGTTCTTGGTCGGTGAATCCGACGGTTTGATGCAGTGGAGAGGACAGAATTATTGGAAGCTAAGGATGCATATACGAGCTAATGTTGATTCTAACTTCCCTGTTGAGTATCTAACGGTCACTACTTCAGGATTAGCTCTTATGGCACGGAACGGGACGGTGGTTGTAGTCCGCGTGGCTTTACCACCGTCCTCTGATTTCCGAGTGGCGAAGATGGATTCATCAGGTAAGTTCATCGTTAGTAGATTCTCCGGGAAGAATCTTGTGACGGAATTCTCTGGTCCTATGGATTCTTGTCAGATTCCGTTTGTCTGCGGTAAGCTCGGGCTTTGTAATCTTGATAACGCTTCGGAAAATCAGAGCTGTTCATGTCCAGATGAGATGCGAATGGATGCTGGTAAGGGTGTGTGTGTTCCGGTTAGCCAATCATTGAGTTTACCTGTTTCTTGTGAAGCAAGAAACATTTCGTATCTCGAACTAGGTCTTGGTGTGTCTTACTTCTCTACTCATTTCACCGATCCTGTGGAACACGGTCTCCCGTTATTGGCTTGTCATGATATTTGCAGTAAGAATTGCTCTTGCCTCGGTGTTTTCTATGAGAACACGTCTCGGTCTTGTTATCTCGTAAAGGACTCGTTTGGTTCTTTGTCTTTAGTAAAGAACTCACCAGAGAATCATGATCTTATTGGATACGTTAAGTTGTCTATCAGAAAAACAAACGCTCAGCCTCCGGGAAACAATAACAGAGGAGGATCTAGCTTCCCTGTGATCGCACTTGTGCTCTTACCTTGCTCTGGTTTCTTCCTTTTGATTGCATTAGGGCTTCTCTGGTGGCGTAGATGTGCAGTGATGAGATACAGTAGCATCCGTGAGAAGCAAGTAACTAGACCCGGGTCGTTCGAATCAGGAGATCTAGGATCTTTCCATATCCCGGGGTTACCTCAGAAATTCGAATTCGAGGAGCTGGAACAAGCAACTGAGAATTTCAAGATGCAGATAGGATCAGGCGGATTTGGATCAGTCTACAAAGGAACTCTCCCAGATGAAACACTCATTGCTGTCAAGAAAATCACAAACCATGGACTTCACGGTAGACAAGAGTTTTGTACGGAAATCGCGATAATTGGAAATATCAGACACACGAATCTAGTGAAACTGCGAGGCTTTTGCGCTCGCGGGAGGCAGTTACTCTTAGTCTACGAGTACATGAACCATGGCTCGTTAGAAAAGACTCTGTTTAGTGGGAATGGTCCGGTGCTTGAGTGGCAAGAAAGGTTTGATATAGCGCTCGGGACTGCTCGCGGGCTCGCGTATCTCCACAGTGGTTGCGACCAGAAGATCATACACTGCGATGTGAAGCCAGAGAACATCTTACTGCACGATCATTTCCAACCTAAGATATCTGATTTCGGGTTATCAAAGCTTCTTAATCAAGAAGAATCAAGTCTGTTCACTACGATGAGAGGTACTCGAGGCTATTTAGCTCCAGAGTGGATAACAAACGCAGCGATCTCCGAGAAAGCTGATGTGTACAGCTATGGAATGGTTTTGTTAGAACTAGTGAGTGGTAGGAAAAACTGTTCTTTTCGATCTCGGAGCAACAGTGTGACGGAGGATAATAATCAGAACCACTCGTCGACTACGACCACTAGTACTGGTTTGGTGTATTTCCCATTGTACGCTTTGGATATGCATGAACAAGGGAGGTATATGGAGCTCGCTGATCCGAGGCTAGAGGGTCGGGTAACGAGCCAAGAGGCTGAGAAGTTGGTTCGGATAGCTTTGTGTTGCGTCCACGAGGAGCCAGCATTGAGGCCAACAATGGCAGCGGTAGTGGGTATGTTCGAAGGAAGTATACCGTTGGGGAACCCGAGGATGGAGTCGTTGAACTTCTTGAGGTTTTATGGGCTGAGGTTTGCGGAGTCTTCCATGGTTGAAGGACAAAATGGGGAGAGTGAAACTATGGTCTTCCACCGGCGAGAGAGCTCTAATAGTGGCGGCTCTAGGCAGTCTGCGTCTTACATAGCGTCTCAGGAAGTGTCCGGCCCGCGATGAGATCACCTAAATGTGAATTatttttgtcttttgttttatttggttttggttactttgTTAATAGTGATAGGCCTTGTTCATATAATCTCTACTATATATGAAAATTATTGAAAAATCTTGACATAGAGACT


Protein sequences

Name Description Sequence
At.22848 translated coding region predicted by ESTScan from UniGene At.22848

MNLTPQGISVIEDGKSQIPVWSTPVLASPVKSLRLTDAGNLLLLDHLNVSLWESFDFPTDSIVLGQRLKLGMFLSGSVSRSDFSTGDYKFLVGESDGLMQWRGQNYWKLRMHIRANVDSNFPVEYLTVTTSGLALMARNGTVVVVRVALPPSSDFRVAKMDSSGKFIVSRFSGKNLVTEFSGPMDSCQIPFVCGKLGLCNLDNASENQSCSCPDEMRMDAGKGVCVPVSQSLSLPVSCEARNISYLELGLGVSYFSTHFTDPVEHGLPLLACHDICSKNCSCLGVFYENTSRSCYLVKDSFGSLSLVKNSPENHDLIGYVKLSIRKTNAQPPGNNNRGGSSFPVIALVLLPCSGFFLLIALGLLWWRRCAVMRYSSIREKQVTRPGSFESGDLGSFHIPGLPQKFEFEELEQATENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMFEGSIPLGNPRMESLNFLRFYGLRFAESSMVEGQNGESETMVFHRRESSNSGGSRQSASYIASQEVSGPR

Domains

Domain Start-End Description Sequence

HMMPfam: PF01453
IPR001480
3-71 B_lectin
Bulb-type lectin domain

LTPQGISVIEDGKSQIPVWSTPVLASPVKSLRLTDAGNLLLLDHLNVSLWESFDFPTDSIVLGQRLKLG

superfamily: SSF51110
IPR001480
10-113 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

VIEDGKSQIPVWSTPVLASPVKSLRLTDAGNLLLLDHLNVSLWESFDFPTDSIVLGQRLKLGMFLSGSVSRSDFSTGDYKFLVGESDGLMQWRGQNYWKLRMHI

Gene3D: G3DSA:2.90.10.10
IPR001480
10-108 no description
Bulb-type lectin domain

VIEDGKSQIPVWSTPVLASPVKSLRLTDAGNLLLLDHLNVSLWESFDFPTDSIVLGQRLKLGMFLSGSVSRSDFSTGDYKFLVGESDGLMQWRGQNYWK

HMMPanther: PTHR24420:SF781
30-768 SUBFAMILY NOT NAMED

VKSLRLTDAGNLLLLDHLNVSLWESFDFPTDSIVLGQRLKLGMFLSGSVSRSDFSTGDYKFLVGESDGLMQWRGQNYWKLRMHIRANVDSNFPVEYLTVTTSGLALMARNGTVVVVRVALPPSSDFRVAKMDSSGKFIVSRFSGKNLVTEFSGPMDSCQIPFVCGKLGLCNLDNASENQSCSCPDEMRMDAGKGVCVPVSQSLSLPVSCEARNISYLELGLGVSYFSTHFTDPVEHGLPLLACHDICSKNCSCLGVFYENTSRSCYLVKDSFGSLSLVKNSPENHDLIGYVKLSIRKTNAQPPGNNNRGGSSFPVIALVLLPCSGFFLLIALGLLWWRRCAVMRYSSIREKQVTRPGSFESGDLGSFHIPGLPQKFEFEELEQATENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMFEGSIPLGNPRMESLNFLRFYGLRFAESSMVEGQNGESETMVFHRRESSNSGGSRQSASYIASQEV

HMMPanther: PTHR24420
30-768 FAMILY NOT NAMED,FAMILY NOT NAMED

VKSLRLTDAGNLLLLDHLNVSLWESFDFPTDSIVLGQRLKLGMFLSGSVSRSDFSTGDYKFLVGESDGLMQWRGQNYWKLRMHIRANVDSNFPVEYLTVTTSGLALMARNGTVVVVRVALPPSSDFRVAKMDSSGKFIVSRFSGKNLVTEFSGPMDSCQIPFVCGKLGLCNLDNASENQSCSCPDEMRMDAGKGVCVPVSQSLSLPVSCEARNISYLELGLGVSYFSTHFTDPVEHGLPLLACHDICSKNCSCLGVFYENTSRSCYLVKDSFGSLSLVKNSPENHDLIGYVKLSIRKTNAQPPGNNNRGGSSFPVIALVLLPCSGFFLLIALGLLWWRRCAVMRYSSIREKQVTRPGSFESGDLGSFHIPGLPQKFEFEELEQATENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMFEGSIPLGNPRMESLNFLRFYGLRFAESSMVEGQNGESETMVFHRRESSNSGGSRQSASYIASQEV

Seg: seg
33-51 seg

LRLTDAGNLLLLDHLNVSL

Seg: seg
224-238 seg

VCVPVSQSLSLPVSC

Gene3D: G3DSA:3.30.200.20
402-477 no description

PQKFEFEELEQATENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGF

superfamily: SSF56112
IPR011009
403-734 Protein kinase-like (PK-like)
Protein kinase-like domain

QKFEFEELEQATENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMFEGSIPLGNPRMESLNFLRFYGLRFAESSMVE

ProfileScan: PS50011
IPR000719
415-714 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMFEGSIPLGNPRM

HMMSmart: SM00219
IPR020635
415-703 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMF

HMMSmart: SM00220
IPR002290
415-703 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ENFKMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAVVGMF

HMMPfam: PF00069
IPR017442
418-699 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KMQIGSGGFGSVYKGTLPDETLIAVKKITNHGLHGRQEFCTEIAIIGNIRHTNLVKLRGFCARGRQLLLVYEYMNHGSLEKTLFSGNGPVLEWQERFDIALGTARGLAYLHSGCDQKIIHCDVKPENILLHDHFQPKISDFGLSKLLNQEESSLFTTMRGTRGYLAPEWITNAAISEKADVYSYGMVLLELVSGRKNCSFRSRSNSVTEDNNQNHSSTTTTSTGLVYFPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMAAV

PatternScan: PS00107
IPR017441
421-444 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGFGSVYKGTLPDETLIAVKK

PatternScan: PS00108
IPR008271
535-547 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDVKPENILL

Seg: seg
633-640 seg

SSTTTTST

Gene3D: G3DSA:1.10.510.10
645-697 no description

FPLYALDMHEQGRYMELADPRLEGRVTSQEAEKLVRIALCCVHEEPALRPTMA

Seg: seg
747-761 seg

RRESSNSGGSRQSAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox