PRGDB00066078 (At.23518)

From PRG Wiki
Jump to: navigation, search
At.23518
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357957 (NM_121319)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana PBS1 (avrPphB susceptible 1); kinase

DNA Sequence

TAATAGTGTGAACACTCGTGGACGACAAAAGAAGCTGCTTCTTCAtctctctctctctccttctctttctctctcAACTCCAATTCGTTTTTACCAGTTTCGAATCTGAACAAAGTTGGGTTTTTTATTGGTACCCAGAATCTCAATTCTCCTTCTTTCCTTCTGGGTATAGGAAAAGTCTCGCCTTTTTTTATATTTATCCAATCGCTCCTGTTCATTGATTCCCCAGTAGGATTGTAGTTTTTGGTTATTGGGAAAATTGAGTAAAGGAGGAGATGGGTTGTTTCTCGTGTTTTGATTCGAGTGATGACGAGAAGCTGAATCCAGTTGATGAATCTAATCATGGTCAGAAGAAACAATCACAACCGACAGTATCCAATAACATATCTGGACTCCCTTCAGGTGGGGAGAAGCTTAGCTCAAAGACCAATGGAGGATCAAAAAGGGAGCTACTGCTTCCAAGGGATGGACTTGGACAAATTGCTGCTCATACATTTGCTTTCCGCGAGCTTGCTGCTGCAACTATGAACTTTCATCCTGACACTTTCTTAGGCGAAGGTGGATTTGGACGTGTCTACAAAGGAAGGCTTGACAGCACCGGTCAGGTTGTTGCTGTTAAACAACTAGACAGGAATGGTCTACAAGGTAACAGAGAATTTCTGGTAGAGGTTCTTATGCTCAGTCTTCTTCATCATCCCAACTTAGTCAACCTTATTGGTTATTGTGCTGATGGAGATCAACGCCTCTTGGTCTACGAGTTTATGCCGTTAGGATCATTGGAAGATCACCTCCACGATCTTCCACCGGATAAGGAGGCCTTAGATTGGAACATGAGAATGAAAATAGCTGCTGGTGCGGCGAAAGGATTGGAATTTCTACATGATAAGGCAAACCCTCCGGTTATTTATAGAGATTTTAAGTCATCAAATATTTTACTGGATGAGGGTTTCCACCCTAAGCTTTCTGATTTTGGACTTGCTAAACTCGGACCAACGGGAGACAAATCTCATGTCTCCACTAGAGTTATGGGAACTTATGGTTATTGTGCTCCCGAGTACGCAATGACGGGACAATTGACAGTAAAATCAGATGTCTACAGTTTTGGTGTGGTTTTTCTCGAGCTCATTACTGGTCGCAAAGCTATAGACAGCGAGATGCCTCATGGAGAGCAGAACCTGGTGGCTTGGGCTCGCCCATTGTTCAACGACAGGCGAAAGTTCATAAAACTGGCTGATCCAAGGTTAAAGGGGCGGTTTCCAACGCGTGCACTCTACCAAGCTTTAGCTGTGGCATCAATGTGCATCCAAGAACAGGCGGCTACACGTCCTCTCATAGCAGATGTTGTCACTGCACTCTCCTATCTTGCAAACCAAGCTTATGATCCAAGTAAAGATGATAGTAGAAGAAACCGGGATGAAAGAGGTGCAAGGTTAATAACAAGGAACGACGATGGAGGTGGCTCGGGAAGTAAATTCGATTTAGAAGGTTCAGAGAAAGAAGATTCACCGAGAGAGACAGCTCGGATATTGAACCGAGATATCAATAGGGAGCGTGCGGTTGCAGAGGCTAAGATGTGGGGAGAGAGTTTGAGGGAGAAACGAAGACAGAGCGAGCAGGGTACTTCAGAGAGCAACAGTACCGGGTAGAACCGGTTTGGGTCGGTCTTGACCCTTTTTTGTTCTTATTTCTCTCAAGACTCTCATTTATTGTCAAACATAGaaaacaaacaaaaaaaCATTGGGACGACGAGTTGCTGTACATTATATATGTGATGTTGCAATATGGGCACAAAGGTTAATAACCAAAACTCTCTAATTGAGATTCTGGAGAGTTGTGAAGATTGTTCATG


Protein sequences

Name Description Sequence
At.23518 translated coding region predicted by ESTScan from UniGene At.23518

MGCFSCFDSSDDEKLNPVDESNHGQKKQSQPTVSNNISGLPSGGEKLSSKTNGGSKRELLLPRDGLGQIAAHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQAYDPSKDDSRRNRDERGARLITRNDDGGGSGSKFDLEGSEKEDSPRETARILNRDINRERAVAEAKMWGESLREKRRQSEQGTSESNSTG

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
56-360 Protein kinase-like (PK-like)
Protein kinase-like domain

KRELLLPRDGLGQIAAHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTAL

HMMPanther: PTHR24420:SF657
68-426 SUBFAMILY NOT NAMED

QIAAHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQAYDPSKDDSRRNRDERGARLITRNDDGGGSGSKFDLEGSEKEDSPRETARILNRDINRER

HMMPanther: PTHR24420
68-426 FAMILY NOT NAMED,FAMILY NOT NAMED

QIAAHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQAYDPSKDDSRRNRDERGARLITRNDDGGGSGSKFDLEGSEKEDSPRETARILNRDINRER

Gene3D: G3DSA:3.30.200.20
71-148 no description

AHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIG

ProfileScan: PS50011
IPR000719
86-363 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYL

HMMSmart: SM00220
IPR002290
86-363 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYL

HMMSmart: SM00219
IPR020635
86-360 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTAL

HMMPfam: PF00069
IPR017442
91-355 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

FLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIAD

PatternScan: PS00107
IPR017441
92-115 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVYKGRLDSTGQVVAVK

Gene3D: G3DSA:1.10.510.10
149-359 no description

YCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTA

PatternScan: PS00108
IPR008271
209-221 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox