PRGDB00066107 (At.25012)

From PRG Wiki
Jump to: navigation, search
At.25012
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 222424033 (AK317302)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT4G24440 mRNA, complete cds, clone: RAFL21-86-A01

DNA Sequence

ATAAAAGCCCCTAATTTTTTCTCCGCCCAAGAGACAAAAATCCTTCGCAATCGAGCAACGGAAGCTCCTGCATCCACCGTCCAAATCTCTTCTAACGTCGCCGGAGATCGGTAAACCGGTTCTTCATCCCGTATTCATCTCTTATTGAGATCGTTGGGGAAGTAGAGAATGGCGACGTTTGAGCTGTACAGGAGATCGACGATCGGGATGTGTCTGACGGAGACTTTGGACGAGATGGTTCAGAGCGGTACGCTGAGCCCTGAGCTAGCTATCCAAGTCCTTGTTCAATTTGACAAGTCCATGACTGAAGCTCTGGAGAGCCAAGTGAAGACCAAGGTGTCCATCAAGGGACACCTGCACACTTACAGGTTCTGTGACAATGTCTGGACCTTCATATTACAGGACGCAATGTTCAAGAGTGACGATCGTCAAGAGAATGTGAGCCGGGTGAAGATAGTGGCATGTGATTCCAAGCTGCTCACACAGTGAGATGCAAATTGTCTGCAGGGAATTTACTTTCCTTTGTACTAGATTTTGAGTTTTTTCACTTTGTAAACTCAGCACTTGCTATATATGTTGAGCACTTGCTATATGTTGAGCTCCATCTGCAGCCATCAATTTAGCCTATATGTAAATTCTCGGCCCAAGGACATAAGGATACATTCTGTTGCTATGAGAAAGTTCTTGAGCTTCaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.25012 translated coding region predicted by ESTScan from UniGene At.25012

MATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVKTKVSIKGHLHTYRFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDSKLLTQ

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF009415
IPR003194
1-106 Transcription initiation factor IIA, gamma subunit
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVKTKVSIKGHLHTYRFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDSKLLTQ

HMMPanther: PTHR10966
IPR003194
1-103 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVKTKVSIKGHLHTYRFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDSKL

BlastProDom: PD009224
IPR015872
1-50 T2AG_ARATH_Q39236;
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALE

Gene3D: G3DSA:1.10.287.190
IPR015872
2-54 no description
Transcription initiation factor IIA, gamma subunit

ATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVK

HMMPfam: PF02268
IPR015872
3-50 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

TFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALE

superfamily: SSF47396
IPR009083
4-54 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVK

superfamily: SSF50784
IPR009088
52-102 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKTKVSIKGHLHTYRFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDSK

HMMPfam: PF02751
IPR015871
52-101 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKTKVSIKGHLHTYRFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDS

Gene3D: G3DSA:2.30.18.10
IPR009088
55-105 no description
Transcription factor IIA, beta-barrel

TKVSIKGHLHTYRFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDSKLLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox