PRGDB00066118 (At.26371)

From PRG Wiki
Jump to: navigation, search
At.26371
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357863 (NM_121090)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RBK1 (Rop Binding protein Kinases 1); ATP binding

DNA Sequence

AGCAAAAGCTGACTCTTCTTCTAACTTTCTATTTCTTCCAAGAATAACAAACTTTTTTCTCATAAGAAACAAAACAAGAATTCTACAAAACTTCTCATTAAACctctgttttcttgtttctcttctgctctgtattttcgataattctctctgttttgtatcctttcttattttctgtgaatctgtttttttATGGAAATTTAATTCAAAGGCTTATTAGAGGAAGaaagaaagaaaaagaaaaaaaaaCCCACTGGAGCTATGGCTGTTGAAGATAACAAGAACAGTGAAAGCAAAAATCATCAAGAGGTAGAGCTTCATAGGAACGACTTAGGCCTCGAAGATTCATCATCGCCAAGAGGTGTTCTCGGAATGGTTTCAGATTCCGACAACAGCAGCAGTAGTTGCAGCTCTTGTTCCTCTGATGATAAATCATCATCAACATCGTCACCATTTTCAAATACTACTAAAACCGTTTCGTCTTCTCACCATGGTCTTCAATGGAACAAAATGATTGAATCTATCAAGAAGAAGTCCATGAGACGATTCTCTGTCATTCCTCTTCTTGCAAGTTACGAACTCACCCGTAAAAACTTGCGTCGTAAGCAACCTAAGCTAACTCCCTCTGAGAGTGCTTTCACCTGTGAAGCCTTCTTTATGGCTAAACCCTCTTGGAGAAACTTCACTTACGAAGAGCTCGCTGTAGCCACCGATTATTTCAATCCTGAGAACATGATTGGTAAGGGAGGACATGCGGAGGTATACAAAGGGGTTTTGATTAATGGTGAGACGGTGGCGATTAAGAAGCTGATGAGTCACGCCAAGGAAGAAGAAGAAAGAGTGAGCGATTTCCTTTCAGAGCTCGGTATAATCGCACATGTAAACCACCCAAACGCAGCTAGGCTTCGCGGTTTCAGCAGTGATCGCGGTTTGCATTTTGTTCTTGAGTACGCTCCCTATGGCAGCCTCGCTTCTATGCTTTTTGGATCAGAGGAATGTCTAGAGTGGAAGATAAGGTATAAAGTGGCTCTAGGTATAGCTGATGGTCTGAGTTATCTTCATAATGCTTGTCCAAGAAGGATCATTCACCGTGACATCAAAGCTTCTAACATATTGCTCAACCACGATTACGAAGCTCAGATTTCAGATTTCGGACTTGCAAAATGGCTCCCAGAGAACTGGCCTCACCATGTTGTATTCCCCATTGAAGGAACATTCGGATATCTAGCTCCAGAGTATTTCATGCACGGCATTGTTGATGAGAAGATTGATGTGTTTGCCTTTGGAGTATTGCTTCTAGAGATCATAACCAGTCGCCGAGCTGTTGATACAGCAAGCAGGCAGAGCATTGTTGCATGGGCAAAACCTTTTCTTGAGAAAAATAGCATGGAGGACATTGTGGATCCTCGGCTAGGAAATATGTTTAATCCAACAGAGATGCAACGAGTGATGCTAACAGCTTCAATGTGTGTACATCATATTGCCGCAATGCGACCTGACATGACTCGGTTGGTGCAGCTGTTACGTGGAGAAGACGGACCAGCTGAGCTACAGCAGAAGGCAGGTGAAAGAACAATGAGCGTGAACGCTTGTGATCTACAAGATCACACCTCTTCCTCATACCTCAACGAACTCCGCCGCCATAGGCAACTCTTAATGGAGTGAGTAGAAGCAATAACATCAACTTAAAGAACTGTTTATCAACCtctttctttttagatttttattttcttgacttgagttttgcttgttattctccattggttgcttttttttCTTGTCCAACCAAACTGTGAATATCTTCAACTTGTGTCTCTCTGTTGCTTCTACTGAACTTTGTTAGTCTCAACCTCTCGGTAGAGTTGTCAATTTGTTACCA


Protein sequences

Name Description Sequence
At.26371 translated coding region predicted by ESTScan from UniGene At.26371

MAVEDNKNSESKNHQEVELHRNDLGLEDSSSPRGVLGMVSDSDNSSSSCSSCSSDDKSSSTSSPFSNTTKTVSSSHHGLQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSWRNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDGPAELQQKAGERTMSVNACDLQDHTSSSYLNELRRHRQLLME

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF794
13-467 PTHR24420:SF794

NHQEVELHRNDLGLEDSSSPRGVLGMVSDSDNSSSSCSSCSSDDKSSSTSSPFSNTTKTVSSSHHGLQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSWRNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDGPAELQQKAGERTMSVNACDLQDHTSSSYLNELRRHRQLLME

HMMPanther: PTHR24420
13-467 PTHR24420,FAMILY NOT NAMED

NHQEVELHRNDLGLEDSSSPRGVLGMVSDSDNSSSSCSSCSSDDKSSSTSSPFSNTTKTVSSSHHGLQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSWRNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDGPAELQQKAGERTMSVNACDLQDHTSSSYLNELRRHRQLLME

superfamily: SSF56112
IPR011009
123-429 Kinase_like
Protein kinase-like domain

ESAFTCEAFFMAKPSWRNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDGPAE

Gene3D: G3DSA:3.30.200.20
137-230 G3DSA:3.30.200.20

SWRNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEY

ProfileScan: PS50011
IPR000719
153-430 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDGPAEL

HMMPfam: PF00069
IPR017442
157-363 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSI

PatternScan: PS00107
IPR017441
159-182 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGHAEVYKGVLINGETVAIKK

Gene3D: G3DSA:1.10.510.10
233-419 G3DSA:1.10.510.10

YGSLASMLFGSEECLEWKIRYKVALGIADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQ

PatternScan: PS00108
IPR008271
274-286 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox