PRGDB00066133 (At.27082)

From PRG Wiki
Jump to: navigation, search
At.27082
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145339843 (NM_116255)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CRCK2; ATP binding

DNA Sequence

GGAGAAGAAAAAGTTGAAAAAATTGTAAAGTCAGTCTCTCCGACTCTTCCTTCCTTCCGTGTTCACCATTGCTACACGTTCTCCACGAACTTTCCGATGCCCAGTCGTCGGAGACATAGCTACACCGTCGGATCTCCTGCAACCACATCTTCCAATTACAGTAACACTACTTTCACCGATCGTTCCTTCCCGACAACCCCTGCCCGTACATCCACCGACACAACCACCTCCATCGCTCGTCGCATCTCCGGTATCTTCATCAACTGCTTCACTCCTCCCGATTCCGTTTCCTCCAACTACATCGACAATTCAAAGTCCTCTTCCGACAATAATATCCGTAGTAGACGTAGCTCAACAGGAAGTAGTAGTGTACAGAGGAGTTATGGAAATGCAAACGAAACAGAGCATACAAGATTCACCTTCGATGAAATCTACGACGCGACCAAGAACTTCTCTCCGTCCTTTAGGATCGGACAAGGCGGTTTTGGCACTGTTTACAAGGTCAAACTCAGAGATGGCAAAACCTTTGCTGTGAAACGTGCCAAAAAGAGTATGCATGACGACCGTCAAGGTGCAGATGCAGAGTTTATGAGTGAGATTCAGACATTAGCTCAAGTTACTCATTTGAGTTTGGTTAAATACTATGGATTTGTTGTTCATAACGACGAGAAGATTCTCGTTGTGGAGTATGTAGCCAATGGAACTCTTAGAGATCACTTGGATTGTAAGGAAGGAAAGACTCTCGACATGGCGACTCGGTTAGATATCGCAACCGATGTAGCTCATGCCATAACCTATCTTCACATGTATACACAGCCACCTATCATCCACAGAGATATCAAATCTTCAAACATTCTCCTCACTGAGAATTACAGAGCCAAGGTTGCTGATTTCGGGTTTGCAAGATTAGCTCCAGATACTGATTCAGGAGCCACGCATGTGTCAACACAAGTCAAAGGAACCGCTGGTTACTTAGACCCAGAGTACTTAACAACGTATCAACTCACAGAGAAAAGTGACGTCTACTCTTTTGGTGTACTGCTCGTCGAGCTTCTCACAGGTCGGCGTCCCATCGAGCTTAGCAGAGGACAAAAAGAACGCATCACCATTAGATGGGCGATCAAGAAGTTCACGAGTGGAGATACGATATCGGTATTGGACCCGAAGCTAGAACAGAATTCAGCGAACAACTTAGCATTAGAGAAGGTATTGGAGATGGCGTTTCAATGTCTAGCTCCTCATAGACGTTCGAGACCAAGCATGAAAAAATGCAGTGAGATTTTGTGGGGAATTCGTAAAGATTACAGAGAGTTGCTCAACACAAGTCTTTGATGATATTATTCTCTACGCttatataatatggttttgaatacacaattatatattatttgtttgaatattaatttgTCATACACGATGCATTCTTGTACGAGAATTGTTGATTTGTAATTGATTTTGAAATTTGTAGTATTATATTAACGTGTATTTGGTGTTAATAAATTGAGTTATTATCATTCT


Protein sequences

Name Description Sequence
At.27082 translated coding region predicted by ESTScan from UniGene At.27082

GEEKVEKIVKSVSPTLPSFRVHHCYTFSTNFPMPSRRRHSYTVGSPATTSSNYSNTTFTDRSFPTTPARTSTDTTTSIARRISGIFINCFTPPDSVSSNYIDNSKSSSDNNIRSRRSSTGSSSVQRSYGNANETEHTRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWGIRKDYRELLNTSL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF813
35-437 SUBFAMILY NOT NAMED

SRRRHSYTVGSPATTSSNYSNTTFTDRSFPTTPARTSTDTTTSIARRISGIFINCFTPPDSVSSNYIDNSKSSSDNNIRSRRSSTGSSSVQRSYGNANETEHTRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWGIRKDYRE

HMMPanther: PTHR24420
35-437 FAMILY NOT NAMED,FAMILY NOT NAMED

SRRRHSYTVGSPATTSSNYSNTTFTDRSFPTTPARTSTDTTTSIARRISGIFINCFTPPDSVSSNYIDNSKSSSDNNIRSRRSSTGSSSVQRSYGNANETEHTRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWGIRKDYRE

Seg: seg
48-59 seg

TTSSNYSNTTFT

Seg: seg
64-83 seg

PTTPARTSTDTTTSIARRIS

Seg: seg
95-127 seg

SVSSNYIDNSKSSSDNNIRSRRSSTGSSSVQRS

superfamily: SSF56112
IPR011009
121-436 Protein kinase-like (PK-like)
Protein kinase-like domain

SSSVQRSYGNANETEHTRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWGIRKDYR

Gene3D: G3DSA:3.30.200.20
135-222 no description

EHTRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHND

ProfileScan: PS50011
IPR000719
151-409 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQ

HMMSmart: SM00220
IPR002290
151-430 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWG

HMMSmart: SM00219
IPR020635
151-428 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEIL

HMMPfam: PF00069
IPR017442
156-426 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAEFMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSE

PatternScan: PS00107
IPR017441
157-183 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGTVYKVKLRDGKTFAVKRAKK

Gene3D: G3DSA:1.10.510.10
223-429 no description

EKILVVEYVANGTLRDHLDCKEGKTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATHVSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRWAIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILW

PatternScan: PS00108
IPR008271
275-287 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox