PRGDB00066152 (At.27667)

From PRG Wiki
Jump to: navigation, search
At.27667
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30689340 (NM_119383)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana SD2-5 (S-DOMAIN-2 5); carbohydrate binding

DNA Sequence

AAGACACTCGCAGCAtctctctacttctctctctctctGTTTCAACCCCTCTTGTCGTCTATCTCCATCAAAAAGACCAAAATCAAACATCATTGAATGTTAGACAGAGAGGCAAAAACTAATCAAAGTGTTTCTAATCCCTGAAAATAAGCCCACTTCTTCTATTTTCCTCATTTCAGTTTCTGGGTTTTAATCGATCTCCCCCTTTCTCACCCTTCCGTCTGAATTCCGGTCTGCAATCGTCGGAAAGTTTTGGACTTTACACCAACGCCAAAGCGAGTTCTTGTTTCTCTGTTTGCTTCTCTAGGACCAATCAGTTTCCATTTACAGATGCGTACTATTCACCTGTCAGAGCTCTGAGATTTGTCTTTTTGCATCTCTCTGAATATTTCTCTTTTCTCAGATCCATTGACCTCATCCACATACATAAAGTTTAGGTATTTTTAAAAGGGTTCAATTCTGGGGTTTACCGGAATTTCATCATCTTTGAAGACCATGAGAGGCGTCTTCATCGTCATCGTAACGTGTCTGGTTTTCTTACCGGATCCTCTACGTGCCGGTGTAGCGTCCATCGGGAGCATCACTCCAGGTTTTGGAGGATCTCAGATGAATTACATCAACAACGATGGTATCTTCCTCGAATCCAACAACTCAGCCTTCGGTTTCGGTTTCGTAACTACACAAGATTCCGTTACTCTGTTCACACTCAGTATCATCCACAAGAGCAGCACGAAACTGATCTGGTCCGCGAACAGAGCTTCCCCTGTTTCCAATTCCGACAAGTTTGTGTTCGATGACAACGGAAATGTGGTGATGGAAGGAACTGAGGTTTGGAGATTGGATAATTCAGGCAAAAACGCTTCAAGAATCGAGCTGCGTGACTCCGGGAATCTCGTTGTTGTTTCCGTTGACGGAACTTCGATCTGGGAGAGTTTTGATCATCCGACAGATACTCTGATCACGAATCAAGCTTTCAAAGAAGGCATGAAGCTCACTAGCAGTCCTTCTTCGAGCAACATGACTTATGCCCTTGAGATCAAATCAGGAGATATGGTTTTATCTGTTAACAGCTTAACCCCTCAAGTGTATTGGTCAATGGCAAATGCCAGAGAGAGGATCATCAACAAAGATGGCGGCGTAGTGACTTCATCGTCTCTCCTTGGGAATTCATGGCGGTTCTTTGATCAGAAACAGGTTTTGTTGTGGCAGTTTGTATTCTCAGACAATAAAGATGATAACACAACTTGGATCGCTGTTTTGGGAAACAACGGTGTGATCTCTTTTTCTAATCTTGGAAGCGGAGCATCTGCTGCCGATTCTTCGACTAAAATACCTAGCGATCTGTGCGGAACACCTGAGCCTTGCGGGCCTTACTATGTCTGCTCGGGTTCTAAAGTGTGTGGATGTGTGTCCGGGTTGTCTCGGGCTCGGTCTGATTGCAAAACCGGGATTACTTCTCCCTGTAAGAAAACCAAGGATAATGCAACATTGCCTTTGCAGCTAGTAAGTGCTGGAGACGGTGTAGACTATTTCGCTCTTGGGTATGCTCCTCCGTTCTCCAAGAAAACTGATCTTGATAGCTGTAAAGAGTTCTGCCACAACAATTGCTCGTGCCTTGGTCTTTTCTTCCAGAACAGTTCTGGTAATTGCTTCTTGTTTGATTATATTGGAAGCTTTAAAACCTCTGGCAATGGAGGCTCTGGGTTTGTGTCTTACATCAAGATCGCAAGTACTGGTTCTGGAGGTGGAGATAACGGAGAAGATGATGGGAAACATTTTCCTTATGTAGTGATTATTGTCGTGGTAACAGTTTTTATCATCGCTGTTTTGATCTTTGTGGCCTTCCGGATTCATAAGAGAAAGAAAATGATTTTGGAGGCTCCTCAAGAGAGTTCAGAAGAAGATAACTTCTTGGAGAACTTATCCGGGATGCCTATTCGGTTCGCTTACAAAGATCTTCAGTCAGCGACGAATAACTTCTCGGTGAAGTTAGGTCAAGGAGGGTTTGGATCGGTCTATGAAGGTACTTTACCAGATGGTTCTCGTCTAGCTGTGAAGAAACTTGAAGGAATCGGTCAAGGGAAGAAAGAATTCAGAGCCGAGGTTAGTATAATCGGAAGTATTCATCATCTGCACTTGGTGCGGCTAAGAGGATTCTGCGCAGAAGGGGCTCATAGGCTGCTCGCATACGAGTTCTTATCCAAAGGTTCGTTGGAGAGATGGATATTTAGGAAAAAGGATGGCGATGTTCTTCTAGATTGGGACACAAGATTTAACATAGCACTCGGAACAGCCAAAGGTTTAGCGTATCTACATGAAGATTGTGATGCAAGGATTGTTCACTGCGATATAAAACCCGAGAACATCCTATTAGACGATAACTTCAATGCCAAGGTATCCGATTTCGGACTGGCGAAGCTCATGACCCGCGAACAAAGCCATGTCTTCACAACAATGCGCGGGACAAGAGGCTACTTGGCTCCAGAATGGATCACAAACTATGCGATATCAGAGAAGAGTGATGTTTACAGCTACGGAATGGTGTTGCTAGAGTTAATAGGAGGAAGAAAGAACTATGATCCATCAGAAACTTCGGAGAAATGCCATTTTCCTTCTTTTGCTTTCAAGAAGATGGAAGAAGGGAAGCTTATGGATATTGTCGATGGGAAGATGAAGAATGTTGATGTGACTGACGAAAGGGTTCAAAGGGCTATGAAAACCGCACTTTGGTGTATACAAGAAGATATGCAAACGAGACCCTCGATGAGCAAAGTTGTTCAAATGCTTGAAGGTGTTTTTCCGGTGGTCCAGCCACCTAGTTCTTCCACTATGGGATCGAGACTTTACTCAAGCTTCTTTAAGTCCATCAGCGAGGACGGCGGTGCTACTACGTCATCTGGACCGTCCGATTGTAACAGTGAGAATTATCTCTCCGCCGTGAGACTCTCCGGTCCGAGATAGCAATCTTTTTAGCCAATTTTTAGTATCTTATATAATAGGTTTTTGGCTCACCATGTTTTGTTGTATATTGTTTTTGTGTTACATCTTAAAAGAATAGCCATCACTCAGTTTTGTAACGTTCCGAGATCAATTATTTCATAGATTACCCGTCGTTTTTCTT


Protein sequences

Name Description Sequence
At.27667 translated coding region predicted by ESTScan from UniGene At.27667

MRGVFIVIVTCLVFLPDPLRAGVASIGSITPGFGGSQMNYINNDGIFLESNNSAFGFGFVTTQDSVTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSPSSSNMTYALEIKSGDMVLSVNSLTPQVYWSMANARERIINKDGGVVTSSSLLGNSWRFFDQKQVLLWQFVFSDNKDDNTTWIAVLGNNGVISFSNLGSGASAADSSTKIPSDLCGTPEPCGPYYVCSGSKVCGCVSGLSRARSDCKTGITSPCKKTKDNATLPLQLVSAGDGVDYFALGYAPPFSKKTDLDSCKEFCHNNCSCLGLFFQNSSGNCFLFDYIGSFKTSGNGGSGFVSYIKIASTGSGGGDNGEDDGKHFPYVVIIVVVTVFIIAVLIFVAFRIHKRKKMILEAPQESSEEDNFLENLSGMPIRFAYKDLQSATNNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEGVFPVVQPPSSSTMGSRLYSSFFKSISEDGGATTSSGPSDCNSENYLSAVRLSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF926
1-779 PTHR24420:SF926

MRGVFIVIVTCLVFLPDPLRAGVASIGSITPGFGGSQMNYINNDGIFLESNNSAFGFGFVTTQDSVTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSPSSSNMTYALEIKSGDMVLSVNSLTPQVYWSMANARERIINKDGGVVTSSSLLGNSWRFFDQKQVLLWQFVFSDNKDDNTTWIAVLGNNGVISFSNLGSGASAADSSTKIPSDLCGTPEPCGPYYVCSGSKVCGCVSGLSRARSDCKTGITSPCKKTKDNATLPLQLVSAGDGVDYFALGYAPPFSKKTDLDSCKEFCHNNCSCLGLFFQNSSGNCFLFDYIGSFKTSGNGGSGFVSYIKIASTGSGGGDNGEDDGKHFPYVVIIVVVTVFIIAVLIFVAFRIHKRKKMILEAPQESSEEDNFLENLSGMPIRFAYKDLQSATNNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEGVFPVVQPPSSSTM

HMMPanther: PTHR24420
1-779 PTHR24420,FAMILY NOT NAMED

MRGVFIVIVTCLVFLPDPLRAGVASIGSITPGFGGSQMNYINNDGIFLESNNSAFGFGFVTTQDSVTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSPSSSNMTYALEIKSGDMVLSVNSLTPQVYWSMANARERIINKDGGVVTSSSLLGNSWRFFDQKQVLLWQFVFSDNKDDNTTWIAVLGNNGVISFSNLGSGASAADSSTKIPSDLCGTPEPCGPYYVCSGSKVCGCVSGLSRARSDCKTGITSPCKKTKDNATLPLQLVSAGDGVDYFALGYAPPFSKKTDLDSCKEFCHNNCSCLGLFFQNSSGNCFLFDYIGSFKTSGNGGSGFVSYIKIASTGSGGGDNGEDDGKHFPYVVIIVVVTVFIIAVLIFVAFRIHKRKKMILEAPQESSEEDNFLENLSGMPIRFAYKDLQSATNNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEGVFPVVQPPSSSTM

HMMPIR: PIRSF000641
IPR024171
3-804 SRK
S-receptor-like serine/threonine-protein kinase

GVFIVIVTCLVFLPDPLRAGVASIGSITPGFGGSQMNYINNDGIFLESNNSAFGFGFVTTQDSVTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSPSSSNMTYALEIKSGDMVLSVNSLTPQVYWSMANARERIINKDGGVVTSSSLLGNSWRFFDQKQVLLWQFVFSDNKDDNTTWIAVLGNNGVISFSNLGSGASAADSSTKIPSDLCGTPEPCGPYYVCSGSKVCGCVSGLSRARSDCKTGITSPCKKTKDNATLPLQLVSAGDGVDYFALGYAPPFSKKTDLDSCKEFCHNNCSCLGLFFQNSSGNCFLFDYIGSFKTSGNGGSGFVSYIKIASTGSGGGDNGEDDGKHFPYVVIIVVVTVFIIAVLIFVAFRIHKRKKMILEAPQESSEEDNFLENLSGMPIRFAYKDLQSATNNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEGVFPVVQPPSSSTMGSRLYSSFFKSISEDGGATTSSGPS

ProfileScan: PS50927
IPR001480
33-148 BULB_LECTIN
Bulb-type lectin domain

FGGSQMNYINNDGIFLESNNSAFGFGFVTTQDSVTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFD

HMMSmart: SM00108
IPR001480
39-150 B_lectin
Bulb-type lectin domain

NYINNDGIFLESNNSAFGFGFVTTQDSVTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHP

superfamily: SSF51110
IPR001480
66-205 B_lectin
Bulb-type lectin domain

VTLFTLSIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSPSSSNMTYALEIKSGDMVLSVNSLTPQVYWSMANAR

Gene3D: G3DSA:2.90.10.10
IPR001480
72-202 Bulb-type_lectin_dom
Bulb-type lectin domain

SIIHKSSTKLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSPSSSNMTYALEIKSGDMVLSVNSLTPQVYWSMA

HMMPfam: PF01453
IPR001480
80-170 B_lectin
Bulb-type lectin domain

KLIWSANRASPVSNSDKFVFDDNGNVVMEGTEVWRLDNSGKNASRIELRDSGNLVVVSVDGTSIWESFDHPTDTLITNQAFKEGMKLTSSP

superfamily: SSF56112
IPR011009
465-772 Kinase_like
Protein kinase-like domain

ESSEEDNFLENLSGMPIRFAYKDLQSATNNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEGVFPVVQ

Gene3D: G3DSA:3.30.200.20
482-567 G3DSA:3.30.200.20

RFAYKDLQSATNNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEF

ProfileScan: PS50011
IPR000719
493-768 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NNFSVKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEGVF

HMMPfam: PF00069
IPR017442
497-762 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VKLGQGGFGSVYEGTLPDGSRLAVKKLEGIGQGKKEFRAEVSIIGSIHHLHLVRLRGFCAEGAHRLLAYEFLSKGSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQ

PatternScan: PS00107
IPR017441
499-522 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGSVYEGTLPDGSRLAVKK

Gene3D: G3DSA:1.10.510.10
571-766 G3DSA:1.10.510.10

GSLERWIFRKKDGDVLLDWDTRFNIALGTAKGLAYLHEDCDARIVHCDIKPENILLDDNFNAKVSDFGLAKLMTREQSHVFTTMRGTRGYLAPEWITNYAISEKSDVYSYGMVLLELIGGRKNYDPSETSEKCHFPSFAFKKMEEGKLMDIVDGKMKNVDVTDERVQRAMKTALWCIQEDMQTRPSMSKVVQMLEG

PatternScan: PS00108
IPR008271
614-626 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDIKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox