PRGDB00066169 (At.27883)

From PRG Wiki
Jump to: navigation, search
At.27883
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145343828 (NM_118505)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat transmembrane protein kinase, putative (AT4G23740) mRNA, complete cds

DNA Sequence

CTTTCACCCACTTTAATATGCCAAAAAATAAGAACAAAATTATATCCGTTGCTTGAAAATCACAAGCTCTTCTTAACTTCACAAGTGCTTCAATGGCGGTTCTTCACATTATCTTCACTGCGTAATTGAAGAAGTTGTTCTCTCTTCCTCTTAATTTCGAGTTGTGTTCTTAAAAAACTCCAGAGCTGATTCGATTCTCGAGAAGAAACTAAGCCGACAATAAAGTTCAGATCTGGAAAAAAGCGAGCTCCAGATTACAAAAAGAAACAGCTCGTTTTTTTCACTTTCAAAAAAATGGAAGCTTTGAGGATTTATCTATGGAGTCTCTGTCTCTCTCTGTGTTTGATTATCTATGGAGCAAACTCAGATCCATTAGAAGACAAACGCGCATTGCTTGAGTTTCTTACCATTATGCAACCAACTCGTTCACTCAACTGGAACGAGACTTCTCAAGTCTGCAACATCTGGACCGGAGTTACTTGTAATCAAGACGGATCTCGAATCATAGCCGTTAGATTACCAGGCGTTGGACTCAATGGTCAGATTCCTCCAAACACTATAAGCAGACTCTCAGCTCTCAGAGTTCTTAGTCTCAGATCCAATCTAATCTCCGGCGAGTTTCCTAAGGATTTTGTTGAGTTGAAAGATTTGGCCTTTCTTTATCTTCAGGATAACAACTTGTCTGGTCCTTTGCCATTGGATTTCTCTGTTTGGAAGAATCTCACTAGTGTTAATCTCTCAAACAACGGGTTCAACGGGACAATCCCGAGTTCGTTGTCTCGTCTTAAGCGGATTCAGTCGTTAAATCTTGCTAACAATACGCTTTCTGGTGATATTCCTGATCTGAGTGTGCTCTCTAGTCTGCAGCACATTGACTTGTCCAACAATTATGATCTTGCTGGACCGATACCAGATTGGCTTCGAAGGTTCCCGTTCTCGTCTTATACAGGCATTGATATTATTCCTCCTGGTGGTAACTACACCCTCGTTACGCCGCCACCACCTAGCGAGCAGACTCATCAGAAACCGTCGAAAGCTCGCTTCTTGGGACTATCCGAGACGGTGTTCTTGTTGATTGTTATTGCTGTTTCCATTGTGGTGATTACGGCTTTGGCGTTTGTGTTGACTGTTTGTTACGTAAGAAGGAAGTTAAGACGCGGTGATGGGGTCATTTCGGATAATAAGTTGCAGAAGAAAGGTGGGATGTCTCCTGAGAAATTTGTTTCTCGGATGGAAGATGTGAACAACCGGTTATCGTTCTTTGAAGGATGTAACTACTCTTTTGATCTTGAGGATCTATTGAGAGCTTCTGCTGAGGTTCTTGGTAAAGGCACGTTTGGCACGACGTACAAAGCAGTTCTTGAAGATGCAACTTCTGTTGCTGTGAAACGTCTTAAGGATGTTGCGGCTGGGAAACGTGATTTCGAGCAGCAGATGGAGATCATTGGAGGTATTAAGCATGAAAACGTTGTGGAGCTTAAGGCATACTATTACTCTAAAGACGAGAAGCTAATGGTTTATGACTATTTCAGCCGAGGAAGTGTGGCTTCTTTGCTTCATGGTAACAGAGGAGAAAACAGGATTCCTCTAGACTGGGAAACAAGAATGAAAATAGCTATTGGCGCAGCTAAAGGGATTGCTCGTATCCACAAAGAAAACAATGGAAAACTCGTCCATGGGAACATCAAATCTTCGAATATATTCTTGAATTCCGAGAGTAATGGCTGTGTCTCTGATCTTGGATTAACTGCTGTAATGAGTCCCTTGGCTCCACCGATATCGAGGCAAGCTGGTTACCGTGCACCAGAAGTAACCGACACAAGGAAGTCTTCTCAATTGTCAGATGTTTACAGCTTCGGTGTTGTTCTACTCGAACTACTCACGGGAAAATCGCCCATTCACACTACCGCAGGGGACGAGATCATCCACTTGGTTAGATGGGTACATTCAGTAGTGAGAGAGGAATGGACCGCAGAAGTATTCGACATCGAGCTTCTGAGGTATACAAACATAGAGGAAGAGATGGTTGAGATGTTGCAGATTGCAATGTCCTGTGTTGTGAAAGCAGCAGATCAGAGGCCAAAGATGTCTGATTTGGTTAGGCTCATCGAGAACGTTGGAAACCGACGAACCAGCATTGAACCGGAACCCGAACTCAAACCCAAATCCGAAAATGGAGCCTCAGAGACTTCAACACCGAGTGAAATTTGAATCTATCAAAATTCTAACTGTTGATTCATCATCCCATATTTTACATATGAAGTTTGTATACTCCTGTGTTTATTTCTTCTCTCTTCGGTTTAGAACCGGTTCAACAAACACATTTCTGTTTAGGAATTCTTGGTTTTCAAAATTCGCTATGAAATAGATTCAAATTTCTGATTCACAAG


Protein sequences

Name Description Sequence
At.27883 translated coding region predicted by ESTScan from UniGene At.27883

MEALRIYLWSLCLSLCLIIYGANSDPLEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGPIPDWLRRFPFSSYTGIDIIPPGGNYTLVTPPPPSEQTHQKPSKARFLGLSETVFLLIVIAVSIVVITALAFVLTVCYVRRKLRRGDGVISDNKLQKKGGMSPEKFVSRMEDVNNRLSFFEGCNYSFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPEPELKPKSENGASETSTPSEI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF850
1-628 SUBFAMILY NOT NAMED

MEALRIYLWSLCLSLCLIIYGANSDPLEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGPIPDWLRRFPFSSYTGIDIIPPGGNYTLVTPPPPSEQTHQKPSKARFLGLSETVFLLIVIAVSIVVITALAFVLTVCYVRRKLRRGDGVISDNKLQKKGGMSPEKFVSRMEDVNNRLSFFEGCNYSFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPEPELKPKSENG

HMMPanther: PTHR24420
1-628 FAMILY NOT NAMED,FAMILY NOT NAMED

MEALRIYLWSLCLSLCLIIYGANSDPLEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGPIPDWLRRFPFSSYTGIDIIPPGGNYTLVTPPPPSEQTHQKPSKARFLGLSETVFLLIVIAVSIVVITALAFVLTVCYVRRKLRRGDGVISDNKLQKKGGMSPEKFVSRMEDVNNRLSFFEGCNYSFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPEPELKPKSENG

Seg: seg
7-20 seg

YLWSLCLSLCLIIY

superfamily: SSF52058
23-212 L domain-like,LRR

NSDPLEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGPIPDWLRRF

HMMPfam: PF08263
IPR013210
27-64 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

LEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCN

Gene3D: G3DSA:3.80.10.10
44-212 no description

RSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGPIPDWLRRF

Seg: seg
90-102 seg

SRLSALRVLSLRS

ProfileScan: PS51450
IPR001611
94-117 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRVLSLRSNLISGEFPKDFVELK

ProfileScan: PS51450
IPR001611
118-139 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLAFLYLQDNNLSGPLPLDFSV

ProfileScan: PS51450
IPR001611
142-165 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTSVNLSNNGFNGTIPSSLSRLK

HMMPfam: PF00560
IPR001611
142-164 LRR_1
Leucine-rich repeat

NLTSVNLSNNGFNGTIPSSLSRL

ProfileScan: PS51450
IPR001611
166-188 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RIQSLNLANNTLSGDIPDLSVLS

HMMPfam: PF00560
IPR001611
189-209 LRR_1
Leucine-rich repeat

SLQHIDLSNNYDLAGPIPDWL

Seg: seg
259-274 seg

LLIVIAVSIVVITALA

superfamily: SSF56112
IPR011009
305-613 Protein kinase-like (PK-like)
Protein kinase-like domain

SPEKFVSRMEDVNNRLSFFEGCNYSFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRT

ProfileScan: PS50011
IPR000719
337-608 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENV

HMMSmart: SM00220
IPR002290
337-605 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLI

HMMSmart: SM00219
IPR020635
337-605 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLI

HMMPfam: PF00069
IPR017442
341-601 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDL

Gene3D: G3DSA:3.30.200.20
343-398 no description

LGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAY

PatternScan: PS00107
IPR017441
343-374 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGTFGTTYKAVLEDATSVAVKRLKDVAAGK

Gene3D: G3DSA:1.10.510.10
399-603 no description

YYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVR

Seg: seg
439-451 seg

KIAIGAAKGIARI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox