PRGDB00066187 (At.28178)

From PRG Wiki
Jump to: navigation, search
At.28178
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357654 (NM_120598)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat transmembrane protein kinase, putative (AT5G05160) mRNA, complete cds

DNA Sequence

GTGTGAGTCACCAAATAGCTCAACCATGAATTCTTCTCACACTGCCTTCGTTGCTGCTTCCTTCTTCTTCCTCTTACTCGCCGCAACCGCGGTTTTGGTTTCAGCCGATTTAGCATCAGACGAACAAGCCCTTCTCAACTTTGCAGCATCAGTCCCACATCCACCAAAACTCAACTGGAACAAGAACCTCTCTCTCTGCTCTTCATGGATCGGCATTACTTGTGATGAATCCAACCCCACCAGCCGCGTTGTAGCTGTCCGTCTTCCAGGAGTTGGCCTCTACGGCTCAATCCCTCCTGCCACATTAGGCAAACTAGACGCTCTCAAAGTCCTTAGCCTCAGATCCAACTCTCTCTTTGGAACTTTACCTTCTGATATTCTCTCACTCCCTTCTCTTGAATACCTTTATCTCCAACACAACAACTTCTCCGGCGAACTCACCACTAATTCTTTGCCGTCGATCTCCAAGCAGCTTGTTGTCTTGGACTTGTCTTATAACTCTTTATCTGGTAACATTCCTTCCGGTCTCCGGAACTTGTCTCAGATCACTGTATTGTACCTTCAAAACAACTCTTTTGATGGTCCCATTGATTCTCTTGATCTCCCGAGTGTAAAAGTTGTAAATTTGAGCTATAACAACTTAAGTGGACCCATCCCTGAGCATCTCAAGAAGTCACCGGAATATTCTTTCATCGGAAACTCATTACTATGTGGTCCACCTCTGAATGCATGTTCCGGAGGAGCCATCTCTCCGTCTTCAAATTTGCCTAGACCGTTGACAGAGAATCTCCATCCTGTCCGGAGGAGACAGAGTAAAGCTTATATAATCGCCATTGTAGTCGGATGCTCTGTGGCCGTTCTTTTCCTTGGGATTGTTTTCTTGGTTTGTCTGGTgaagaagacgaagaaagaagaagGAGGCGGTGAAGGAGTGCGAACGCAGATGGGGGGAGTGAATAGCAAGAAACCGCAGGATTTCGGGAGCGGAGTTCAAGATCCAGAGAAGAACAAGCTCTTCTTCTTCGAAAGATGCAATCATAATTTCGATCTTGAGGATCTCTTGAAAGCTTCTGCTGAAGTTCTTGGTAAAGGGAGTTTCGGAACGGCCTACAAGGCCGTGCTTGAGGACACAACCGCAGTGGTGGTGAAACGTTTAAGAGAAGTCGTGGCGAGCAAGAAAGAGTTTGAACAGCAAATGGAGATAGTTGGGAAGATTAACCAGCATTCTAATTTCGTACCACTCCTCGCTTATTACTATTCGAAAGACGAGAAGCTATTGGTCTACAAGTACATGACGAAAGGAAGCTTGTTCGGGATCATGCACGGAAACAGAGGAGACAGAGGAGTCGACTGGGAAACGCGGATGAAGATCGCGACAGGGACTTCAAAAGCAATCTCTTACCTTCACTCCTTAAAATTCGTTCACGGAGACATCAAATCATCAAACATACTTCTCACTGAAGACCTTGAGCCATGTCTGTCCGACACATCTTTAGTCACTCTCTTCAACCTTCCAACTCACACACCGCGAACCATTGGCTACAATGCTCCTGAAGTTATTGAGACGAGGAGAGTCAGTCAAAGATCAGACGTTTATAGCTTTGGTGTGGTGATTCTCGAAATGCTAACCGGGAAGACACCTTTAACTCAGCCTGGTCTCGAGGATGAGCGTGTCGTCATTGATCTTCCGAGATGGGTTCGGTCTGTTGTGAGAGAAGAGTGGACTGCAGAGGTTTTCGATGTGGAGCTCTTGAAGTTTCAGAACATTGAAGAGGAGATGGTTCAGATGCTTCAGCTAGCGTTGGCCTGTGTTGCAAGGAATCCAGAATCGAGGCCAAAGATGGAAGAGGTCGCGAGGATGATTGAAGATGTGAGGAGATTGGATCAGTCTCAGCAGTTACAGCAAAACAGAACATCCTCAGAGGCTACTTCCAATGTCTCTGAATGATTCCTCATTCCGACCAAAAGTTTCTTTGATCAATTCTACTTCTAT


Protein sequences

Name Description Sequence
At.28178 translated coding region predicted by ESTScan from UniGene At.28178

XCESPNSSTMNSSHTAFVAASFFFLLLAATAVLVSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPEYSFIGNSLLCGPPLNACSGGAISPSSNLPRPLTENLHPVRRRQSKAYIIAIVVGCSVAVLFLGIVFLVCLVKKTKKEEGGGEGVRTQMGGVNSKKPQDFGSGVQDPEKNKLFFFERCNHNFDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQSQQLQQNRTSSEATSNVSE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF779
1-647 SUBFAMILY NOT NAMED

XCESPNSSTMNSSHTAFVAASFFFLLLAATAVLVSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPEYSFIGNSLLCGPPLNACSGGAISPSSNLPRPLTENLHPVRRRQSKAYIIAIVVGCSVAVLFLGIVFLVCLVKKTKKEEGGGEGVRTQMGGVNSKKPQDFGSGVQDPEKNKLFFFERCNHNFDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQSQQLQQNRTSSEATSNV

HMMPanther: PTHR24420
1-647 FAMILY NOT NAMED,FAMILY NOT NAMED

XCESPNSSTMNSSHTAFVAASFFFLLLAATAVLVSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPEYSFIGNSLLCGPPLNACSGGAISPSSNLPRPLTENLHPVRRRQSKAYIIAIVVGCSVAVLFLGIVFLVCLVKKTKKEEGGGEGVRTQMGGVNSKKPQDFGSGVQDPEKNKLFFFERCNHNFDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQSQQLQQNRTSSEATSNV

Seg: seg
16-40 seg

AFVAASFFFLLLAATAVLVSADLAS

superfamily: SSF52058
35-246 L domain-like,LRR

SADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPEYSFIGNSLLCGPPLNACS

HMMPfam: PF08263
IPR013210
39-76 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCD

Gene3D: G3DSA:3.80.10.10
40-228 no description

SDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPE

HMMPfam: PF13855
97-143 LRR_8,Leucine rich repeat

SIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNF

HMMPfam: PF00560
IPR001611
158-180 LRR_1
Leucine-rich repeat

QLVVLDLSYNSLSGNIPSGLRNL

Seg: seg
300-311 seg

KKTKKEEGGGEG

superfamily: SSF56112
IPR011009
324-630 Protein kinase-like (PK-like)
Protein kinase-like domain

PQDFGSGVQDPEKNKLFFFERCNHNFDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQ

HMMSmart: SM00219
IPR020635
355-622 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMI

ProfileScan: PS50011
IPR000719
356-628 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRL

HMMSmart: SM00220
IPR002290
356-631 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQS

Gene3D: G3DSA:3.30.200.20
359-431 no description

AEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKY

HMMPfam: PF00069
IPR017442
360-619 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVA

PatternScan: PS00107
IPR017441
362-384 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSFGTAYKAVLEDTTAVVVK

Gene3D: G3DSA:1.10.510.10
432-641 no description

MTKGSLFGIMHGNRGDRGVDWETRMKIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWTAEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQSQQLQQNRTSS

PatternScan: PS00108
IPR008271
474-486 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FVHGDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox