PRGDB00066200 (At.28557)

From PRG Wiki
Jump to: navigation, search
At.28557
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 17528989 (AY065229)
Gene Class Unknown
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana unknown protein (At5g25620) mRNA, complete cds

DNA Sequence

TCCGGTTTACACTCTCATCAAAACACAAACACAACGcttatctctctcactctctttactcattcttctcatttggataagatctctctctttctcTCCCTCCTTTTCAGCAGATTCAATCCAAACCCTAACCTCTTTGATTCCGATCTTTAGAGAATATTTCTCTTCAAAAAATCCATTATAAATACTTTTACTTAACTAAAACttttttttttaccatctctctttttttttttACTTACTCCATATGCCATCAATGTCAAATTGTTCTTTCTGTCCTTTGTTCTTAATTAGTGTCACCACCACCACCACTACTTCTATACTACAAACCCTTCTCGTATTCTCTTAACCAATACGTACTTATTACACCAAAAGTCTCTTTCTCTCtatatatatataGATAACAGCCAAGAGAGAGAACCAAGAAGAAGTTATTTTCTTGATGGATTTCTGTTGGAAGAGAGAGATGGAAGGTAAACTAGCACATGACCACCGCGGCATGACGTCACCGCGTCGTATCTGCGTCGTCACCGGTCCGGTGATCGTAGGCGCCGGACCGTCGGGACTAGCCACGGCAGCATGTTTAAAAGAGAGAGGTATCACGTCCGTACTACTAGAGAGATCAAACTGTATAGCATCACTATGGCAGCTCAAGACTTATGACCGTCTTCATCTTCACCTTCCTAAACAATTCTGTGAACTTCCGATTATACCCTTCCCCGGAGATTTCCCTACCTACCCGACGAAGCAACAGTTCATCGAGTACCTTGAGGACTACGCTCGGAGGTTTGACATAAAGCCGGAGTTTAACCAAACGGTTGAGTCGGCTGCGTTTGATGAAAACCTTGGGATGTGGCGCGTGACTAGCGTGGGAGAAGAAGGCACGACGGAGTATGTTTGTCGGTGGTTAGTGGCGGCGACGGGGGAGAATGCGGAGCCGGTGGTACCTAGGTTTGAGGGGATGGATAAGTTTGCAGCCGCCGGGGTAGTTAAGCACACGTGTCATTATAAAACCGGTGGAGATTTCGCCGGAAAAAGGGTTCTTGTCGTCGGATGTGGAAACTCCGGTATGGAGGTTTGTTTGGATCTCTGCAACTTCGGTGCTCAGCCTTCTCTCGTTGTCAGAGACGCTGTGCACGTCCTACCACGAGAGATGTTGGGTACTTCAACTTTTGGGCTGTCCATGTTCTTACTGAAATGGCTGCCCATCCGGCTTGTTGACCGTTTCCTTTTGGTTGTTTCCCGGTTCATCCTCGGGGATACTACCCTTTTAGGTCTTAACAGGCCCCGGTTAGGTCCACTCGAGCTCAAAAATATCTCCGGTAAAACTCCGGTTCTCGACGTTGGCACGCTAGCCAAAATCAAAACCGGAGACATTAAGGTGTGTTCGGGGATAAGAAGGTTAAAACGACATGAAGTTGAGTTCGATAACGGAAAAACAGAGAGATTTGACGCCATTATATTAGCAACTGGCTACAAAAGCAACGTACCCTCTTGGCTAAAGGAGAATAAAATGTTTAGTAAGAAAGATGGATTTCCAATACAAGAGTTCCCTGAGGGATGGAGAGGGGAATGTGGGCTATACGCGGTCGGATTCACAAAACGTGGGATTAGTGGAGCATCAATGGATGCAAAGAGAATAGCTGAAGACATACACAAGTGTTGGAAACAAGACGAGCAAGTaaaaaaaaTCTGAATCAAAACTTATTGACTAGACAGTAGAGAAAAGCTAAGGTTTTCTATCAAGAAAACATAACTTGCCAAATGCCGGTAGCGATCGaaaaaaaaTTGATGGTTTTGTTTCAAAGGAGGTGATGTAAATTAAGACTTATCTCCAGCTGCAATGCAAATTGGGGAAAAGAATGAAAAGGAAATTTAGTGAGAGTGATTGTGGTGGGAATTGATGATCATCTGCCCCAAAGGAGAGGAGGGGACCCTCTTCTCTTTGCATGCTTATAACCCACTTTGTAAATCTTTCTATACcttctttctatgtttctaatttttctttttctcttttctttcttttatttttgtttttttagatttccatagttaggtatgctctttgtttttcttctcttttttggttcaattttttttggcataaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.28557 translated coding region predicted by ESTScan from UniGene At.28557

MEGKLAHDHRGMTSPRRICVVTGPVIVGAGPSGLATAACLKERGITSVLLERSNCIASLWQLKTYDRLHLHLPKQFCELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFNQTVESAAFDENLGMWRVTSVGEEGTTEYVCRWLVAATGENAEPVVPRFEGMDKFAAAGVVKHTCHYKTGGDFAGKRVLVVGCGNSGMEVCLDLCNFGAQPSLVVRDAVHVLPREMLGTSTFGLSMFLLKWLPIRLVDRFLLVVSRFILGDTTLLGLNRPRLGPLELKNISGKTPVLDVGTLAKIKTGDIKVCSGIRRLKRHEVEFDNGKTERFDAIILATGYKSNVPSWLKENKMFSKKDGFPIQEFPEGWRGECGLYAVGFTKRGISGASMDAKRIAEDIHKCWKQDEQVKKI

Domains

Domain Start-End Description Sequence

superfamily: SSF51905
12-307 FAD/NAD(P)-binding domain

MTSPRRICVVTGPVIVGAGPSGLATAACLKERGITSVLLERSNCIASLWQLKTYDRLHLHLPKQFCELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFNQTVESAAFDENLGMWRVTSVGEEGTTEYVCRWLVAATGENAEPVVPRFEGMDKFAAAGVVKHTCHYKTGGDFAGKRVLVVGCGNSGMEVCLDLCNFGAQPSLVVRDAVHVLPREMLGTSTFGLSMFLLKWLPIRLVDRFLLVVSRFILGDTTLLGLNRPRLGPLELKNISGKTPVLDVGTLAKIKTGDIKVC

HMMPanther: PTHR23023:SF5
16-405 MONOOXYGENASE,MONOOXYGENASE

RRICVVTGPVIVGAGPSGLATAACLKERGITSVLLERSNCIASLWQLKTYDRLHLHLPKQFCELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFNQTVESAAFDENLGMWRVTSVGEEGTTEYVCRWLVAATGENAEPVVPRFEGMDKFAAAGVVKHTCHYKTGGDFAGKRVLVVGCGNSGMEVCLDLCNFGAQPSLVVRDAVHVLPREMLGTSTFGLSMFLLKWLPIRLVDRFLLVVSRFILGDTTLLGLNRPRLGPLELKNISGKTPVLDVGTLAKIKTGDIKVCSGIRRLKRHEVEFDNGKTERFDAIILATGYKSNVPSWLKENKMFSKKDGFPIQEFPEGWRGECGLYAVGFTKRGISGASMDAKRIAEDIHKCWKQDEQ

HMMPanther: PTHR23023
16-405 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

RRICVVTGPVIVGAGPSGLATAACLKERGITSVLLERSNCIASLWQLKTYDRLHLHLPKQFCELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFNQTVESAAFDENLGMWRVTSVGEEGTTEYVCRWLVAATGENAEPVVPRFEGMDKFAAAGVVKHTCHYKTGGDFAGKRVLVVGCGNSGMEVCLDLCNFGAQPSLVVRDAVHVLPREMLGTSTFGLSMFLLKWLPIRLVDRFLLVVSRFILGDTTLLGLNRPRLGPLELKNISGKTPVLDVGTLAKIKTGDIKVCSGIRRLKRHEVEFDNGKTERFDAIILATGYKSNVPSWLKENKMFSKKDGFPIQEFPEGWRGECGLYAVGFTKRGISGASMDAKRIAEDIHKCWKQDEQ

FPrintScan: PR00469
IPR000103
23-45 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPVIVGAGPSGLATAACLKERGI

FPrintScan: PR00368
IPR013027
24-43 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PVIVGAGPSGLATAACLKER

Gene3D: G3DSA:3.50.50.60
25-220 no description

VIVGAGPSGLATAACLKERGITSVLLERSNCIASLWQLKTYDRLHLHLPKQFCELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFNQTVESAAFDENLGMWRVTSVGEEGTTEYVCRWLVAATGENAEPVVPRFEGMDKFAAAGVVKHTCHYKTGGDFAGKRVLVVGCGNSGMEVCLDLCNFGAQPSLVVR

HMMPfam: PF00743
IPR020946
26-346 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLATAACLKERGITSVLLERSNCIASLWQLKTYDRLHLHLPKQFCELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFNQTVESAAFDENLGMWRVTSVGEEGTTEYVCRWLVAATGENAEPVVPRFEGMDKFAAAGVVKHTCHYKTGGDFAGKRVLVVGCGNSGMEVCLDLCNFGAQPSLVVRDAVHVLPREMLGTSTFGLSMFLLKWLPIRLVDRFLLVVSRFILGDTTLLGLNRPRLGPLELKNISGKTPVLDVGTLAKIKTGDIKVCSGIRRLKRHEVEFDNGKTERFDAIILATGYKSNVPSWLK

FPrintScan: PR00469
IPR000103
187-211 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FAGKRVLVVGCGNSGMEVCLDLCNF

FPrintScan: PR00368
IPR013027
191-209 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEVCLDLC

Seg: seg
268-281 seg

LLGLNRPRLGPLEL

Gene3D: G3DSA:3.50.50.60
290-402 no description

VLDVGTLAKIKTGDIKVCSGIRRLKRHEVEFDNGKTERFDAIILATGYKSNVPSWLKENKMFSKKDGFPIQEFPEGWRGECGLYAVGFTKRGISGASMDAKRIAEDIHKCWKQ

superfamily: SSF51905
310-402 FAD/NAD(P)-binding domain

IRRLKRHEVEFDNGKTERFDAIILATGYKSNVPSWLKENKMFSKKDGFPIQEFPEGWRGECGLYAVGFTKRGISGASMDAKRIAEDIHKCWKQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox