PRGDB00066201 (At.28598)

From PRG Wiki
Jump to: navigation, search
At.28598
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145352877 (NM_119615)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT4G34500) mRNA, complete cds

DNA Sequence

ctctctcattttatttttttgttaaagctctcatcagtcatcatcgtcttttctcttttgtttGTTTGCTCCTAACGTTTCTCTTTCTTGGAACAATCTCCAGCAAACCAAACTAATCCGTCTGAGAGAAGTAGTTTTGACTTTCTCTACTCCGTGATCGCGATGTCGGACTCTGGTGGTGGTTCTCACAAGTCCTCCACAACAAAACCTTCCGTTTTCGGACTAAACCTTTACTTAGTCATCGCGATTTGTTCTGTTTTCATACTCTTGATCTCACTCTTGATCTTCCTCTTCGTCTGCTTGAATCGCGTCTCACGCGCTCGTAGAATGCGCGTTAAACACAGCTCCGGCTCGATCCCGCTCGTCTCTAAAGAAATCTCGGAGATCAAGACGGTCGGCAAATTCATAAACTCCGACGATTCCAAGGGTAAAATCGGAAACGAAGTTGTTGTTGTTGTCTCCGCCACAAGCAAAGAAGCGACAAGTGGTTTTGATACTTTGTCGGTGGCTTCGAGCGGTGACGTTGGTACTTCTGAGGCAATGGGATGGGGAAAATGGTACAGCTTGAAAGATCTGGAGATTGCGACACGTGGCTTCTCTGATGATAACATGATCGGTGAAGGAGGGTACGGTGTCGTTTACAGAGCTGATTTCTCTGACGGTTCTGTCGCCGCCGTCAAGAATCTCCTTAACAACAAGGGTCAGGCGGAGAAGGAGTTCAAAGTTGAAGTAGAAGCAATTGGGAAAGTAAGACATAAGAACTTGGTTGGTCTGATGGGATATTGTGCTGACAGTGCTCAAAGTCAAAGGATGCTTGTGTATGAATATATTGATAATGGAAACTTGGAGCAGTGGTTACACGGTGATGTAGGTCCGGTGAGTCCTCTTACGTGGGATATCCGCATGAAGATAGCCATTGGAACAGCAAAAGGATTAGCCTATTTACATGAAGGGCTTGAACCTAAGGTTGTGCACCGTGATGTGAAATCTAGTAACATCTTGCTCGATAAGAAATGGAACGCGAAAGTGTCTGATTTTGGTTTGGCCAAGTTATTAGGATCTGAAACAAGCTACGTGACAACTCGTGTGATGGGAACTTTTGGATATGTTTCACCGGAATATGCAAGTACTGGTATGCTCAATGAGTGTAGTGATGTCTACAGTTTCGGTGTTCTGCTCATGGAGATCATTACAGGAAGGAGCCCAGTTGATTATTCAAGACCGCCTGGCGAGATGAACTTAGTGGATTGGTTCAAAGGAATGGTTGCAAGTAGACGTGGAGAAGAAGTTATAGACCCTAAAATCAAGACATCACCTCCTCCAAGAGCTTTGAAAAGAGCTTTGCTTGTTTGTTTGCGTTGCATAGACCTTGACTCTAGTAAACGACCAAAGATGGGACAAATCATTCACATGCTTGAGGCTGAAGATTTTCCATTCCGTCCTGAACACAGATCAAACCAGGAAAGATCGAAGTAAGAAAGATTATTGGGCAAACAATAATGTCTTGGGGAAGACCACACTTGAGCGTTGATGCTATTCATTACACAGCCATATATTGATAGATGTTTCCATGTTTGTTCTTATATTGAGAGGATTGATATGCAAAAGAGAAAATTGGAAAAGTGAAATTAGATATATGAGGATGAAATTCAGATTTATCGCTTGTAATTTGTAAATATATCATATATTGTATAATAAAACAGTGAACTCTAAGAACATTTCTTCCC


Protein sequences

Name Description Sequence
At.28598 translated coding region predicted by ESTScan from UniGene At.28598

MSDSGGGSHKSSTTKPSVFGLNLYLVIAICSVFILLISLLIFLFVCLNRVSRARRMRVKHSSGSIPLVSKEISEIKTVGKFINSDDSKGKIGNEVVVVVSATSKEATSGFDTLSVASSGDVGTSEAMGWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFPFRPEHRSNQERSKKKDYWANNNVLGKTTLER

Domains

Domain Start-End Description Sequence

Seg: seg
2-17 seg

SDSGGGSHKSSTTKPS

HMMPanther: PTHR24420:SF894
16-430 SUBFAMILY NOT NAMED

PSVFGLNLYLVIAICSVFILLISLLIFLFVCLNRVSRARRMRVKHSSGSIPLVSKEISEIKTVGKFINSDDSKGKIGNEVVVVVSATSKEATSGFDTLSVASSGDVGTSEAMGWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFPFRPEHR

HMMPanther: PTHR24420
16-430 FAMILY NOT NAMED,FAMILY NOT NAMED

PSVFGLNLYLVIAICSVFILLISLLIFLFVCLNRVSRARRMRVKHSSGSIPLVSKEISEIKTVGKFINSDDSKGKIGNEVVVVVSATSKEATSGFDTLSVASSGDVGTSEAMGWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFPFRPEHR

Seg: seg
29-47 seg

ICSVFILLISLLIFLFVCL

superfamily: SSF56112
IPR011009
115-426 Protein kinase-like (PK-like)
Protein kinase-like domain

VASSGDVGTSEAMGWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFPFR

Gene3D: G3DSA:3.30.200.20
132-208 no description

WYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYC

ProfileScan: PS50011
IPR000719
145-426 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFPFR

HMMSmart: SM00220
IPR002290
145-425 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFPF

HMMSmart: SM00219
IPR020635
145-418 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHML

HMMPfam: PF07714
IPR001245
149-418 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLMGYCADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHML

PatternScan: PS00107
IPR017441
151-173 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYGVVYRADFSDGSVAAVK

Gene3D: G3DSA:1.10.510.10
209-424 no description

ADSAQSQRMLVYEYIDNGNLEQWLHGDVGPVSPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRVMGTFGYVSPEYASTGMLNECSDVYSFGVLLMEIITGRSPVDYSRPPGEMNLVDWFKGMVASRRGEEVIDPKIKTSPPPRALKRALLVCLRCIDLDSSKRPKMGQIIHMLEAEDFP

PatternScan: PS00108
IPR008271
269-281 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox