PRGDB00066202 (At.28604)

From PRG Wiki
Jump to: navigation, search
At.28604
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79317903 (NM_001035960)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana LAG13 (LAG1 LONGEVITY ASSURANCE HOMOLOG 3) (LAG13) mRNA, complete cds

DNA Sequence

ACATTGAATCATCTGATTTGCAGAAAAAGGAGATCTCTTTATGTAAAAGTCTCTGAGAATTTTGGTTTAAAGAGAGGATTTTACGGAGATGGGTTTGTTGGAATCGGTGAAATCAATCAACTGGGAACATGAATCATCTCCGGTTTATCAGGATTTTCGAgttcttcctctcttcgctgtgttcttcccttcgattcgatttctcctcgatagattcgtcttcGAGAAATTGGCAAAATATTTGATCTATGGAAAACATAGACAGGATATGGGAGATGACACAACCGAGAGAAAGAAGAAGATCAGGAAATTCAAAGAATCGGCCTGGAAGTGTGTTTACTATCTATCAGCTGAGATTCTTGCTTTATCTGTGACTTACAATGAGCCTTGGTTTATGAACACTAAATACTTTTGGGTAGGGCCTGGAGATCAGACTTGGCCTGATCAACAAACAAAGTTAAAGTTGAAGCTTTTGTATATGTTTGTGGCTGGTTTCTATACATACTCCATCTTTGCTCTGGTTTTCTGGGAAACGAGGCGTTCTGATTTTGGAGTTTCAATGGGTCATCATATTGCCACTCTTATTCTTATTGTTCTCTCATACGTATGTAGCTTCTCCCGTGTTGGTTCTGTTGTTCTGGCACTTCACGATGCTAGTGATGTGTTTCTTGAGGTTGGGAAAATGTCTAAATATAGTGGAGCTGAAAGAATCGCAAGCTTTTCGTTCATTCTTTTCGTTTTGTCTTGGATCATTCTCCGCCTCATTTACTATCCCTTTTGGATCCTATGGAGTACAAGCTATGAAGTAGTTTTGGAGCTTGATAAAGACAAGCATCCAATCGAAGGACCAATTTACTACTACATGTTTAACACTCTCCTATATTGCTTGCTTGTTCTTCACATTTATTGGTGGGTTTTGATGTATCGGATGCTTGTGAAACAAATACAAGATAGAGGCAAGCTTAGTGAAGATGTCAGATCAGATTCTGAAGGCGAAGATGAGCACGAAGACTGATTTGATCACAAAGGTAGATAGAAATGTAAAAGCACGTTGTTCTCTCTTTACATATTCGCAGATTCTTTTGTTCTCTGTCTCTGTGATTCTGATCGCTAATGGGTGTTTAAGAGTGGAGGAGACTGAGTCATCAATCTCTAACATTGGACCAACTCATGGAACATAACTGATTCAGGAGACATGAAACTGTAGTTGTATTGAATTGTAGTCTGAACAAATTCCAGATCTTCTTGTATTGTATTCATTTCTTGTTTTGGATCACTCACCATTCATGATATATATCAATGTTGATATAACTCATCAATCTCTAACATTGGACCAACTCATGGAACATAACTGATTCAGGAGACATGAAACTGTAGTTGTATTGAATTGTAGTCTGAACAAATTTTG


Protein sequences

Name Description Sequence
At.28604 translated coding region predicted by ESTScan from UniGene At.28604

MGLLESVKSINWEHESSPVYQDFRVLPLFAVFFPSIRFLLDRFVFEKLAKYLIYGKHRQDMGDDTTERKKKIRKFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQQTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVGSVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEVVLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYRMLVKQIQDRGKLSEDVRSDSEGEDEHED


Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF005225
IPR016439
1-307 Longevity assurance proteins LAG1/LAC1
Longevity assurance, LAG1/LAC1

MGLLESVKSINWEHESSPVYQDFRVLPLFAVFFPSIRFLLDRFVFEKLAKYLIYGKHRQDMGDDTTERKKKIRKFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQQTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVGSVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEVVLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYRMLVKQIQDRGKLSEDVRSDSEGEDEHE

HMMPanther: PTHR12560
12-308 FAMILY NOT NAMED,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

WEHESSPVYQDFRVLPLFAVFFPSIRFLLDRFVFEKLAKYLIYGKHRQDMGDDTTERKKKIRKFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQQTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVGSVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEVVLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYRMLVKQIQDRGKLSEDVRSDSEGEDEHED

ProfileScan: PS50922
IPR006634
73-287 TLC
TRAM/LAG1/CLN8 homology domain

RKFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQQTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVGSVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEVVLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYRMLVKQIQ

HMMSmart: SM00724
IPR006634
73-287 TRAM, LAG1 and CLN8 homology domains.
TRAM/LAG1/CLN8 homology domain

RKFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQQTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVGSVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEVVLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYRMLVKQIQ

HMMPfam: PF03798
IPR006634
74-280 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

KFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQQTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVGSVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEVVLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox