PRGDB00066204 (At.28670)

From PRG Wiki
Jump to: navigation, search
At.28670
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145340010 (NM_116916)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana MAPKKK10; ATP binding

DNA Sequence

GACGTCGTCTACAGACTACAATGGACGTAACTGCTATCTTCGCCGGTGATATTTTGGTGCAATCCAGAGAGTATCTTATCCCTAATGATGTTGTGGATGTTGATGGTGGTATTAAAGCGGTAAGACCACCAATAATTCAGCCCCCTCCGGGAAGAAAACTACCTCTTATTGACTTTCCAGGATCATCGTGGGATTTCCTTACGTATTTTGCTCCAAGTAAAACAGTTAAGCGGCAGAGTTCCTCCTCTTCTGATAATACCTCTGATAAAGAGGAAGTTGAAACGGAAGAGACGCGAGGTATGTTTGTCCAGTTGGGGGATACGGCTCATGAGGCATGCCCATTCGCTACAAACGAGGCTGACTCCTCCAGTACAGTATCCATTATTTCGCCGAGTTATGCCTCTAGAGGTTCTATCGTCCCTTCTTGGCTGAAGAGGAAATTTCTGGGACGAGTATCATTAGGTTTTGTGTATGAAGGCAGTTCAGGTTCCTCCGTTGGTTCCGAGTCGACTTGTTCCTTGATGACGCCTTCTCTGGAGTTCCCGGATCGCATCAGTTTCCGGAAAAAGGATTTCAGTGAAAAAGGTCCTAGTCGACACGTTTGGGAAAAGCGTAAATTGACGCGTGCCAAGTTGATTGAAAATTTTTGCAATCCGGAGGACATTGAACCAGTCACATCTTGGCTGAAGGGTCAACTTCTAGGAGAAGAATCATTTGCCTCTGTGTATGAAGCCATTTCAGATTCCTCTGTTGGTTCCGAGTCGACTTGTTCCTTGATGACGCCTTCTATGGAGTTCCCGGATCGCATCAGTTTCCGAAAAAGGGATTTCAGCGAAGAAGGTCCTAGTGGACGTGTTAAGGAAAAGCGTAAATTGATGCGTAACAAGTTGATTGAGAATTTTCGTAAGCCTGAGGATATCACGTCTTGGCTGAAGGGTCAACTTCTAGGACGAGGATCATATGCCTCTGTGTATGAAGCCATTTCAGAAGATGGGGACTTCTTTGCTGTCAAGGAAGTTTCACTTCTTGATAAGGGAATTCAGGCACAAGAATGCATTCAACAACTTGAGGGGGAGATTGCACTACTTAGTCAGCTTCAGCATCAGAATATTGTGCGATATCGTGGCACAGCCAAGGACGTGTCAAAATTGTACATCTTTCTTGAGCTTGTAACCCAAGGATCCGTTCAAAAACTCTACGAAAGATACCAACTTAGCTACACAGTAGTCTCCTTGTATACAAGACAAATTCTTGCTGGGTTGAATTATCTCCACGATAAAGGCTTTGTTCACAGGGACATTAAATGTGCAAATATGTTGGTGGACGCTAATGGCACCGTCAAACTTGCAGATTTTGGATTGGCAGAGGCGTCAAAGTTCAACGACATTATGTCTTGCAAGGGAACATTATTTTGGATGGCTCCGGAGGTTATTAACCGAAAGGATAGTGATGGCAATGGAAGTCCAGCTGATATATGGAGCCTTGGGTGCACTGTGCTGGAAATGTGTACTGGTCAGATCCCCTACTCCGATCTAAAACCCATTCAAGCCGCGTTTAAGATTGGAAGGGGTACGCTTCCAGACGTACCTGATACTTTATCACTAGACGCTCGGCATTTCATACTTACGTGTCTCAAAGTGAACCCGGAAGAGCGGCCAACTGCAGCTGAACTGCTGCACCATCCATTTGTTATAAATCTTTGATTCTTACGCTGAAACAATCAAACTATGCAATAGTATGGCGAAAACCATTTCTTTGATTCTGGTCAAAGCCAAGTTAATTGAAGTGTGAAGTGTCTATATAATTCAACTTGTTTCCCGTTGAAGAGTTATCGCAATGATGGATTTATAAAACTTATTCGAAAGGTTTTCGACTCCGTAC


Protein sequences

Name Description Sequence
At.28670 translated coding region predicted by ESTScan from UniGene At.28670

XRRLQTTMDVTAIFAGDILVQSREYLIPNDVVDVDGGIKAVRPPIIQPPPGRKLPLIDFPGSSWDFLTYFAPSKTVKRQSSSSSDNTSDKEEVETEETRGMFVQLGDTAHEACPFATNEADSSSTVSIISPSYASRGSIVPSWLKRKFLGRVSLGFVYEGSSGSSVGSESTCSLMTPSLEFPDRISFRKKDFSEKGPSRHVWEKRKLTRAKLIENFCNPEDIEPVTSWLKGQLLGEESFASVYEAISDSSVGSESTCSLMTPSMEFPDRISFRKRDFSEEGPSGRVKEKRKLMRNKLIENFRKPEDITSWLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFVINL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361:SF63
37-564 SUBFAMILY NOT NAMED

GIKAVRPPIIQPPPGRKLPLIDFPGSSWDFLTYFAPSKTVKRQSSSSSDNTSDKEEVETEETRGMFVQLGDTAHEACPFATNEADSSSTVSIISPSYASRGSIVPSWLKRKFLGRVSLGFVYEGSSGSSVGSESTCSLMTPSLEFPDRISFRKKDFSEKGPSRHVWEKRKLTRAKLIENFCNPEDIEPVTSWLKGQLLGEESFASVYEAISDSSVGSESTCSLMTPSMEFPDRISFRKRDFSEEGPSGRVKEKRKLMRNKLIENFRKPEDITSWLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFV

HMMPanther: PTHR24361
37-564 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

GIKAVRPPIIQPPPGRKLPLIDFPGSSWDFLTYFAPSKTVKRQSSSSSDNTSDKEEVETEETRGMFVQLGDTAHEACPFATNEADSSSTVSIISPSYASRGSIVPSWLKRKFLGRVSLGFVYEGSSGSSVGSESTCSLMTPSLEFPDRISFRKKDFSEKGPSRHVWEKRKLTRAKLIENFCNPEDIEPVTSWLKGQLLGEESFASVYEAISDSSVGSESTCSLMTPSMEFPDRISFRKRDFSEEGPSGRVKEKRKLMRNKLIENFRKPEDITSWLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFV

Seg: seg
80-84 seg

SSSSS

Seg: seg
122-135 seg

SSSTVSIISPSYAS

Seg: seg
159-170 seg

EGSSGSSVGSES

Gene3D: G3DSA:3.30.200.20
274-418 no description

KRDFSEEGPSGRVKEKRKLMRNKLIENFRKPEDITSWLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQIL

superfamily: SSF56112
IPR011009
296-566 Protein kinase-like (PK-like)
Protein kinase-like domain

KLIENFRKPEDITSWLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFVIN

ProfileScan: PS50011
IPR000719
310-564 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFV

HMMSmart: SM00219
IPR020635
310-563 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

WLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPF

HMMSmart: SM00220
IPR002290
310-564 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WLKGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFV

HMMPfam: PF00069
IPR017442
312-564 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KGQLLGRGSYASVYEAISEDGDFFAVKEVSLLDKGIQAQECIQQLEGEIALLSQLQHQNIVRYRGTAKDVSKLYIFLELVTQGSVQKLYERYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFV

PatternScan: PS00107
IPR017441
316-338 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGSYASVYEAISEDGDFFAVK

Gene3D: G3DSA:1.10.510.10
419-564 no description

AGLNYLHDKGFVHRDIKCANMLVDANGTVKLADFGLAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLGCTVLEMCTGQIPYSDLKPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLHHPFV

PatternScan: PS00108
IPR008271
429-441 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FVHRDIKCANMLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox