PRGDB00066213 (At.28795)

From PRG Wiki
Jump to: navigation, search
At.28795
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79612981 (NM_203185)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT5G49470) mRNA, complete cds

DNA Sequence

AAAGATAAGCAAATTAGTTTTCCTTCTTTGTTGACTCTCTCCAGATTCTGTTTCTTCTTCCTTAATCCATCTCTCAAGCTTCTCCACCATTTTCACCTTGATTCAGCTTCTCCGATTCAAACTCAGATTTGATCTCCGTTGATTTGATTTGACTGCGTTTTTCTGGCAATGGAGAAGACGACTCCACCAGCGGAGGAGCTTCTAAAGAAGATACGAGAGTTAGAAGAAAGCCAAGAGCATCTAAAACGAGAGATGTCGAGACTTAAAGTATCGGCGGAGATGAAGCAGCGTTCGCATTCAGCATCGCCGCAACGTCCTGTGAGGAGAAACAGTAACGACGGAACTCCGATGTGGAGAAAAACCGGTGCGGCTTCGTTTCGTCACGCTTCTCCGTTGCGTAAGGAGAGCCATGCGAAAGTTGCCGGCGGCGGAGGCGAGGGGCAATCGGCAGGCAAGTTCACCGATAAACAGTATTTGAATATTTTGCAGTCTATGGCTCAAGCTGTTCATGTCTTCGATCTAAATGGCCAAATTATCTTTTGGAACTCAATGGCGGAGAAGCTTTATGGATTCTCAGCTTCAGAAGCACTGGGGAAGGATCCGATTGATATTCTTGTAGATGTTCAGGATGCTTCGGTTGCACAGAATATCACTCGGCGTTGCAGTAGTGGAGAGAGTTGGACTGGTGAGTTTCCTGTAAAGAACAAAGCTGGAGAGAGGTTTTCAGTTGTGACTACGATGTCTCCTTCTTATGATGATGATGGTTGTCTTATTGGGATCATATGTATCACAAATGATTCGGCACTCTTTCAAGACCCGAGAGGCTCTCCGGCTAAGACAAGGAGGGGGCAAGAAGGTGAAACGAGCTTTAGTCGGGTGACTAGTAGTGTTGCATCTAAGCTTGGTCTTGACTCGAAAGAGGCGGTTGTATCAAAACTTGGCCTTGATTCTCAGCAGCCTATACAAGTTGCTATAGCTTCAAAGATATCAGATTTGGTGGGCAACAAGGTCAAGTCGAAAATGCGAGCAGGTGATAATAACGCTGCAAACCTTGAGGGTGGAAGTGGGGACAGTCATCAATCTGATCAGGGTTTCTTTGATGCTGCTTTCGCTGACCGGAGGGAGGATGCAGCAACAAGTGGTGCTGATACACCTAGGGGGGATTTTATCCAATCTCCTTTTGGTGTATTCTTACGTAGCGATGAGAAAGCTTCTACAAAGCCCTTCAGAGATTCCAGTGATGAAAGTGATGGAAACTCTGTTGTACCTAAAACACTGACCTCAAAAGCTGAAGAGTGGATGGTAAAGAAAGGATTATCATGGCCATGGAAAGGGAATGAAAGGGAAGGTTTGGAAGGAAGGCGTAGTCATTCTGTGTGGCCTTGGGTGCGGAATGAACAACAAAAACAACAGGCTTATCAAAGCAATTCTAATCACAGTGTTAAGTCTGAAAGCCAGGCATGTGAAAGTATTAAGGCTTCCAGTAACGAGCCTATGGGGTATTGGTCTTCCTCTGTTAATGTGAACAGCACAAGCAGTAGTAGCAGCTGTGGAAGTACCAGCAGCAGTGTTATGAACAAGGTCGATATGGATAGTGACTGCTTGGATTATGAAATCTTATGGGAAGATTTGACAATTGGAGAACAAATCGGGCAAGGTTCATGTGGAACTGTCTATCACGGTCTATGGTTTGGATCCGATGTGGCTGTAAAGGTGTTTTCCAAACAAGAATATTCAGAAGAGATCATAACATCTTTTAGACAAGAGGTATCGTTGATGAAAAGACTTAGACATCCTAACGTTTTACTGTTTATGGGAGCCGTGACATCACCTCAGCGTCTCTGTATAGTGACAGAGTTCCTTCCACGGTTTGGTCTTATTACTTTGGCTAATATTACACTTCCTTTTGTGCTATTCGAACTCCGGGGCCAAAACTCTGACTTACCCTATCAAATAACATTTGCAGTGGAAGTCTCTTCCGTTTGCTGCAGAGGAACACGTCAAAACTGGATTGGAGGCGACGTATCCATATGGCCTCGGATATTCTATCTTGCGTATTATTCTTTGGACTCTTTAATTCAGTTACTGTATCTTGTCTACAACATGTTACACATTTTTCTTACATACTTCTTCGCACAGGCTCGTGGCATGAATTATCTTCACCATTGTACTCCACCGATCATTCACCGAGATTTGAAGTCATCAAATCTACTGGTTGATAAAAACTGGACCGTGAAGGTTGCTGACTTTGGTCTTTCGCGTATCAAGCATGAGACGTACCTCACTACAAAGACAGGAAGGGGAACGCCTCAATGGATGGCACCGGAAGTTCTCCGAAATGAGGCTGCTGATGAAAAGTCTGACGTTTACAGCTTTGGAGTAATACTATGGGAGCTGGTGACTGAGAAGATCCCGTGGGAAAGTCTAAATGCTATGCAGGTGATTGGAGCTGTAGGGTTCATGAACCAGAGACTGGAAGTCCCGAAAAATGTTGATCCTCAGTGGATTTCTTTAATGGAAAGCTGCTGGCATAGTGAACCGCAGGACAGACCATCGTTCCAAGAAATTATGGAGAAACTAAGAGAGCTTCAAAGAAAGTACACTATACAGTTTCAGGCGGCTCGTGCTGCATCAATAGAAAACTCTGCCCTCAAGGAAAAATAAACCATTAAATGGACCGAGCGGAGTCTGATTATGCGTTGAGAAAGCTGAGCTACATAAGCAAAGCAGAAAGGTGTTTCATGTTTGCGTTGAAGCGCAATGACGAGAAGCACCAAAAAGAAGGGTTTTGGTATATGCAAACATATTCTCTCGAGCCATTCTTTTGTATGGAATTGATTCTGAAAACGTCATCGATTGCGAGGCGAGCTAAAGAGGTTATTTATGTAAAACCATTATGCCTGTGACAGACCCAATTTTTTAAGAATAGTCTGTACAGGTGAAAGTATGAGATAGAATCAAGATTTGGAACACTGATTCTGAGTAAATATTGCCATTTTTATTGGAACATGCCTTGTT


Protein sequences

Name Description Sequence
At.28795 translated coding region predicted by ESTScan from UniGene At.28795

MEKTTPPAEELLKKIRELEESQEHLKREMSRLKVSAEMKQRSHSASPQRPVRRNSNDGTPMWRKTGAASFRHASPLRKESHAKVAGGGGEGQSAGKFTDKQYLNILQSMAQAVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGESWTGEFPVKNKAGERFSVVTTMSPSYDDDGCLIGIICITNDSALFQDPRGSPAKTRRGQEGETSFSRVTSSVASKLGLDSKEAVVSKLGLDSQQPIQVAIASKISDLVGNKVKSKMRAGDNNAANLEGGSGDSHQSDQGFFDAAFADRREDAATSGADTPRGDFIQSPFGVFLRSDEKASTKPFRDSSDESDGNSVVPKTLTSKAEEWMVKKGLSWPWKGNEREGLEGRRSHSVWPWVRNEQQKQQAYQSNSNHSVKSESQACESIKASSNEPMGYWSSSVNVNSTSSSSSCGSTSSSVMNKVDMDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAVEVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKLRELQRKYTIQFQAARAASIENSALKEK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50112
IPR000014
98-169 PAS
PAS

TDKQYLNILQSMAQAVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGE

superfamily: SSF55785
99-210 SSF55785

DKQYLNILQSMAQAVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGESWTGEFPVKNKAGERFSVVTTMSPSYDDDGCLIGIICITND

Gene3D: G3DSA:3.30.450.20
99-204 G3DSA:3.30.450.20

DKQYLNILQSMAQAVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGESWTGEFPVKNKAGERFSVVTTMSPSYDDDGCLIGI

HMMSmart: SM00091
IPR000014
100-167 PAS
PAS

KQYLNILQSMAQAVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSS

HMMTigr: TIGR00229
IPR000014
100-210 Sensory_box
PAS

KQYLNILQSMAQAVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGESWTGEFPVKNKAGERFSVVTTMSPSYDDDGCLIGIICITND

HMMPfam: PF13426
112-210 PAS_9,PAS domain

AVHVFDLNGQIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGESWTGEFPVKNKAGERFSVVTTMSPSYDDDGCLIGIICITND

HMMSmart: SM00086
IPR001610
172-213 PAC
PAC motif

TGEFPVKNKAGERFSVVTTMSPSYDDDGCLIGIICITNDSAL

HMMPanther: PTHR23257
289-826 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

DNNAANLEGGSGDSHQSDQGFFDAAFADRREDAATSGADTPRGDFIQSPFGVFLRSDEKASTKPFRDSSDESDGNSVVPKTLTSKAEEWMVKKGLSWPWKGNEREGLEGRRSHSVWPWVRNEQQKQQAYQSNSNHSVKSESQACESIKASSNEPMGYWSSSVNVNSTSSSSSCGSTSSSVMNKVDMDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAVEVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKLRELQRKYTIQFQAARAASIENS

HMMPanther: PTHR23257:SF80
289-826 PTHR23257:SF80,MAP3K DELTA-1 PROTEIN KINASE

DNNAANLEGGSGDSHQSDQGFFDAAFADRREDAATSGADTPRGDFIQSPFGVFLRSDEKASTKPFRDSSDESDGNSVVPKTLTSKAEEWMVKKGLSWPWKGNEREGLEGRRSHSVWPWVRNEQQKQQAYQSNSNHSVKSESQACESIKASSNEPMGYWSSSVNVNSTSSSSSCGSTSSSVMNKVDMDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAVEVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKLRELQRKYTIQFQAARAASIENS

superfamily: SSF56112
IPR011009
450-804 Kinase_like
Protein kinase-like domain

VNVNSTSSSSSCGSTSSSVMNKVDMDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAVEVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKL

Gene3D: G3DSA:3.30.200.20
487-566 G3DSA:3.30.200.20

DLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP

ProfileScan: PS50011
IPR000719
488-812 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAVEVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKLRELQRKYT

HMMPfam: PF07714
IPR001245
488-804 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAVEVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKL

Gene3D: G3DSA:1.10.510.10
651-816 G3DSA:1.10.510.10

LTYFFAQARGMNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPEVLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWISLMESCWHSEPQDRPSFQEIMEKLRELQRKYTIQFQ

FPrintScan: PR00109
IPR001245
665-683 TYRKINASE
Serine-threonine/tyrosine-protein kinase

HHCTPPIIHRDLKSSNLLV

PatternScan: PS00108
IPR008271
671-683 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKSSNLLV

FPrintScan: PR00109
IPR001245
712-722 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTPQWMAPEVL

FPrintScan: PR00109
IPR001245
731-753 TYRKINASE
Serine-threonine/tyrosine-protein kinase

SDVYSFGVILWELVTEKIPWESL

FPrintScan: PR00109
IPR001245
775-797 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDPQWISLMESCWHSEPQDRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox