PRGDB00066251 (At.30045)

From PRG Wiki
Jump to: navigation, search
At.30045
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79529692 (NM_123858)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana transmembrane receptor (AT5G44900) mRNA, complete cds

DNA Sequence

CTTCTTGTTTTTCCTCAGCAAATAGTTTCCTCAAAAACCATTACCTTCCATGGGCGCCTCCTTCTCCCTCTTTACCGACGTTGGACCGATCCCGCCTCAGTATCAAGTGTTCATCAACTTCCGAGGCGAAAAACTTCGTGATGGGTTCCTAGGGTTTCTTGTGGATGCTCTTTTAAAAGAGAATGTCAACGTTTTTATAGATGATCATGAGCTTAGAGGCAGAGATCTTGATCATCTCTTCAGTAGGATCGAGGAATCGAGAGTCGCATTGACAATCTTCTCCAAGAACTTCACCAACTCAAGATGGTGCTTAGATGAGCTTGCTAAGATCAAAGAATGTGTGGATCAAGAAAGTCTTACAGTGATTCCTATCTTCTTTAAGATGAAAACAGACGATGTGAAGAAACTGAAGGGGAATTTTGGAGACAACTTCCGGGACCTGAAGTTAACGCATCGCGGCGAGCCTGAAACTTATCGGAGATGGAAAGATGCTATACTGTATGTTTCTAAGAAAACTGGCTTGTCTTCGTCACGATACAGTCGCCAGAATGATTTGGTCAACACAATCGTCGAGGAGGTTAAGAAAGTTCTAAACGATATCGCCGAGATCGAACGACAAATTGCTGAAGAGAAGCGCAACCATTTGGCGGCAAGAACAGATGAATTGATTAGACTTGTTGTCCGGTTCCTAAGTCTGTTTCTTCtttttacaatagtttttggtccttatgttttaggccttctcacttttttctcttttcttGTGGGTCGTTTGATAATCAATCGAGCTGTGGAAAGTGAGTGGTGAATGGTAACGTTTGCGTTTCTATGAGAATACGTAAACGCAAAGAATCTGAGACTGA


Protein sequences

Name Description Sequence
At.30045 translated coding region predicted by ESTScan from UniGene At.30045

XFLFFLSKXFPQKPLPSMGASFSLFTDVGPIPPQYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGLSSSRYSRQNDLVNTIVEEVKKVLNDIAEIERQIAEEKRNHLAEEQMN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
23-175 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SLFTDVGPIPPQYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGL

ProfileScan: PS50104
IPR000157
33-172 TIR
Toll-Interleukin receptor

PQYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKK

Gene3D: G3DSA:3.40.50.10140
34-158 no description

QYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPET

HMMSmart: SM00255
IPR000157
34-172 Toll
Toll/interleukin-1 receptor homology (TIR) domain

QYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKK

HMMPfam: PF01582
IPR000157
37-165 TIR
Toll-Interleukin receptor

VFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDA

HMMPanther: PTHR23155:SF66
44-193 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

EKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGLSSSRYSRQNDLVNTIVEE

HMMPanther: PTHR23155
44-193 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGLSSSRYSRQNDLVNTIVEE

Coil: coil
187-222 coiled-coil

VNTIVEEVKKVLNDIAEIERQIAEEKRNHLAEEQMN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox