PRGDB00066266 (At.31022)

From PRG Wiki
Jump to: navigation, search
At.31022
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358335 (NM_122223)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT5G23170) mRNA, complete cds

DNA Sequence

GCAAACTTACCGATGAAGGAGTTCGATTACGACAAGCTTGTCACTGCCATAGATCGATTCTCTCCTTCGAAACTCATCGGTAAAGGAAGCCATGGCTATGTTTATAAAGCCCTTCTTCATCACCAAGACGTTGACGAAACACGTCAAAGAGTCGTAGCCATTAAAACaccatcatcattatctccctcatcaccatcctcatcatcatcatcaaaatcaGAACAAACGAAGAAACTAGAAAACGAGATCGACGTTATGTCATCGTTACCTTATCACCCACACGTGTTAAGCTTTCTCGGCCATGCCGAGAAAAAACTCATGGTCGTTGAGTACATGCCAAACGAATCGTTATACCAATTATTACACGTGTCAACTGATCCTCTTCCCACGTGGCTTAAACGCATCGAAATCGCTCTTCAGATCGCGAGTGCGGTTCACTTCCTCCATGAACACGGTATCATCCACCGCGATATCAAATCGGAAAATATTTTGTTTGATTCGAATTGGGAAGCGAAGCTTGCTGACTTCGGACTCGCCGTTGATTTTGGAGGTGATAAGAAGATAAGACCGGCTCCGGCGGGAACTATTGGATACTTAGATCCGTGTTACACGTTACCGGAGAATCTGAGTATGAAGACTGATGTTTATAGTTACGGTGTCGTTTTGTTGGAGATTGTTAGTTGTAGAAAAGCTATTGACGTCTCTCGTTCGCCGGCGTCGATAGTAGACTGGGCGGTTCCGTTGATtaaggaagggaggatcggagaaatatgcggcggaggaggaggaggaTCGGGTGTTTTCCGGGGAATGAGTCTACGGTTGTTGCGTATGGCGGCGAGATGCGTTTCATCTGACGTGGAATCACGACCGTGTTTCGGGGAGATCACGGCGGAGATAGTGGCGTGTTTGGCGGAACCGTTGAAGAGTTTGCCGTTATGGATGAGCGTTTTGCGTCGGGTTGTTAAACTGAAACGGCGGAAAAAACGGTTGAGAGAAACGCTGACGTGGCCGGGTCAAACTTGCCGCGTTTGGTGAGAGTTTATGAATTGCGGGTCAAATATCGAATCGGGTCGGGTTAAAAGGTTGGGTTGGTTACAAAAAGAAAACAACCATCTAAATCCAAGCAGAAGAACAATCGCTAAACAGAATGATATATTTATCGTTTGTAGTAAGTAGCATTTAATTTTGTTATCCCTTCGGATAATGTAACCATTAATCCATTACTAATTCAGTCGTGGTCGATTGATAT


Protein sequences

Name Description Sequence
At.31022 translated coding region predicted by ESTScan from UniGene At.31022

ANLPMKEFDYDKLVTAIDRFSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEIVACLAEPLKSLPLWMSVLRRVVKXETAEKTVERNADVAGSNLPRLVRVYELRVKYRIGSG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF439
5-312 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MKEFDYDKLVTAIDRFSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEIVACLAEPLKSLP

HMMPanther: PTHR24420
5-312 FAMILY NOT NAMED,FAMILY NOT NAMED

MKEFDYDKLVTAIDRFSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEIVACLAEPLKSLP

superfamily: SSF56112
IPR011009
9-329 Protein kinase-like (PK-like)
Protein kinase-like domain

DYDKLVTAIDRFSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEIVACLAEPLKSLPLWMSVLRRVVKXETAEK

Gene3D: G3DSA:3.30.200.20
11-142 no description

DKLVTAIDRFSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIA

ProfileScan: PS50011
IPR000719
20-302 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEIVA

HMMSmart: SM00220
IPR002290
20-302 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEIVA

HMMSmart: SM00219
IPR020635
20-300 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPSKLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITAEI

HMMPfam: PF07714
IPR001245
24-298 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KLIGKGSHGYVYKALLHHQDVDETRQRVVAIKTPSSLSPSSPSSSSSSKSEQTKKLENEIDVMSSLPYHPHVLSFLGHAEKKLMVVEYMPNESLYQLLHVSTDPLPTWLKRIEIALQIASAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITA

PatternScan: PS00107
IPR017441
26-55 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGSHGYVYKALLHHQDVDETRQRVVAIK

Seg: seg
57-73 seg

PSSLSPSSPSSSSSSKS

Gene3D: G3DSA:1.10.510.10
143-298 no description

SAVHFLHEHGIIHRDIKSENILFDSNWEAKLADFGLAVDFGGDKKIRPAPAGTIGYLDPCYTLPENLSMKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGGSGVFRGMSLRLLRMAARCVSSDVESRPCFGEITA

PatternScan: PS00108
IPR008271
153-165 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSENILF

Seg: seg
251-270 seg

EGRIGEICGGGGGGSGVFRG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox