PRGDB00066273 (At.31384)

From PRG Wiki
Jump to: navigation, search
At.31384
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145353768 (NM_119744)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT4G35780) mRNA, complete cds

DNA Sequence

ATACATTACACCctctctctctcttctcttcaatttccgtcttctcactctctAATCTTTTCGCCTTTAGTTGAATCTCTGGGATCATTCTACCTTTTTGTGGATTTAGGATCGAAGAAGAGATCACTCCTACTGTTGAATTCTGGTTTTACTTGAGAGAGTTTTTCAATTCTGATCTGCTGTTTTGCGATGGCGATCAAAGAGGAGACGGAGGAGAGTTGCGGAAGCAGAGCCGTGGTAGCTTCAATAACGAAAGAAAGCCCTAGACAGCACCGTATGAAACTGGAGGTGTACGGTGAGGTTCTTCAACGAATCCAGGAATCCAATTACGAAGAAGCTAATTTCCCTGGTTTTGATGATCTCCTCTGGCTTCACTTCAATCGTCTTCCTGCTCGATATGCTTTGGATGTAAATGTTGAGAGAGCAGAAGATGTACTTACTCATCAGAGATTGTTGAAATTGGCTGAAGATCCTGCTACTAGACCTGTTTTCGAAGTTCGTTGTGTGCAGGTTTCTCCCACATTGAATGGAAATTCTGGTGACGTTGATCCTTCGGATCCTGCGGTCAATGAAGATGCTCAAAGCTCCTATAACTCGAGGTCTCTTGCACCTCCAACTTTTGGTTCTTCTCCGAATTTCGAAGCTCTTACTCAAGCTTACAAAGATCATGCTCAAGACGATGATAGTGCTGTCAATGCACAGTTGCCTAATTCTCGACCGATGCACGAAATCACCTTTTCTACAATCGACAGGCCGAAACTCCTTAGTCAGCTAACTTCCATGCTTGGTGAACTTGGATTGAATATTCAAGAGGCTCATGCTTTCTCTACCGCCGATGGTTTCTCTCTCGATGTATTTGTTGTTGATGGCTGGTCGCAGGAGGAAACAGAAGGTTTAAAAGATGCATTGAAGAAGGAGATAAGAAAGTTTAAGGATCAACCTTGTTCAAAACAGAAATCTATCACTTTCTTTGAGCATGACAAATCAACCAACGAGCTGCTACCTGCGTGTGTTGAAATACCTACGGATGGAACTGATGAGTGGGAAATTGACATGAAGCAGCTCAAAATTGAAAAAAAGGTGGCATGTGGATCATACGGGGAACTATTTAGAGGAACCTATTGTAGTCAGGAAGTAGCTATCAAAATTCTCAAGCCTGAGCGTGTTAATGCGGAAATGCTACGAGAGTTTTCTCAGGAAGTATATATAATGAGGAAAGTTCGGCATAAAAATGTTGTCCAGTTCATTGGTGCATGTACACGATCACCAAACCTCTGCATTGTGACAGAGTTCATGACTCGGGGGAGCATTTATGATTTCCTTCACAAACACAAAGGGGTTTTTAAAATTCAATCTTTGCTCAAAGTGGCACTCGACGTCTCGAAAGGAATGAATTATCTGCATCAAAACAATATTATTCATAGAGACCTTAAGACTGCTAATCTTCTTATGGACGAACATGAAGTTGTCAAAGTTGCCGATTTTGGTGTTGCCAGAGTGCAGACTGAGTCAGGGGTTATGACAGCGGAAACAGGGACATACCGATGGATGGCTCCAGAGGTCATTGAGCACAAACCTTATGATCACAGGGCAGATGTCTTCAGCTACGCGATTGTGCTGTGGGAACTTTTGACTGGGGAACTCCCATATTCTTACTTGACTCCACTGCAAGCTGCTGTTGGCGTTGTCCAAAAGGGACTTAGACCAAAAATTCCAAAGGAAACACACCCAAAACTGACTGAACTTCTTGAGAAATGCTGGCAGCAAGACCCAGCTCTAAGACCCAATTTTGCAGAAATCATAGAAATGCTTAACCAACTAATCCGCGAGGTTGGAGATGATGAGCGCCACAAGGATAAACATGGTGGTTACTTTTCAGGCCTAAAAAAAGGCCATCGTTGACTCTCTCGGGTGCGCTGAAAAATTTGGTTTGATCGGTTTGATAGAGCTCTACTCACTTCTCGTTTTTTCGTTGTACAGTTTCTTAGAGCCTCACTCTTTTTGTCCATGTATAATTTTCTTAAAAAACAATCTCCTTTTGATACAATTATCACTGCAGAGATTGATTTGGATTGCAACTCAATAAAGTGAAAGCCATTCTTTTGAAGCC


Protein sequences

Name Description Sequence
At.31384 translated coding region predicted by ESTScan from UniGene At.31384

MAIKEETEESCGSRAVVASITKESPRQHRMKLEVYGEVLQRIQESNYEEANFPGFDDLLWLHFNRLPARYALDVNVERAEDVLTHQRLLKLAEDPATRPVFEVRCVQVSPTLNGNSGDVDPSDPAVNEDAQSSYNSRSLAPPTFGSSPNFEALTQAYKDHAQDDDSAVNAQLPNSRPMHEITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDGWSQEETEGLKDALKKEIRKFKDQPCSKQKSITFFEHDKSTNELLPACVEIPTDGTDEWEIDMKQLKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIREVGDDERHKDKHGGYFSGLKKGHRXLSRVR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23257:SF82
13-554 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

SRAVVASITKESPRQHRMKLEVYGEVLQRIQESNYEEANFPGFDDLLWLHFNRLPARYALDVNVERAEDVLTHQRLLKLAEDPATRPVFEVRCVQVSPTLNGNSGDVDPSDPAVNEDAQSSYNSRSLAPPTFGSSPNFEALTQAYKDHAQDDDSAVNAQLPNSRPMHEITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDGWSQEETEGLKDALKKEIRKFKDQPCSKQKSITFFEHDKSTNELLPACVEIPTDGTDEWEIDMKQLKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIREVGDDERH

HMMPanther: PTHR23257
13-554 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

SRAVVASITKESPRQHRMKLEVYGEVLQRIQESNYEEANFPGFDDLLWLHFNRLPARYALDVNVERAEDVLTHQRLLKLAEDPATRPVFEVRCVQVSPTLNGNSGDVDPSDPAVNEDAQSSYNSRSLAPPTFGSSPNFEALTQAYKDHAQDDDSAVNAQLPNSRPMHEITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDGWSQEETEGLKDALKKEIRKFKDQPCSKQKSITFFEHDKSTNELLPACVEIPTDGTDEWEIDMKQLKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIREVGDDERH

superfamily: SSF55021
174-250 ACT-like

NSRPMHEITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDGWSQEETEGLKDALKKEIRKFKDQ

HMMPfam: PF01842
IPR002912
179-227 ACT
Amino acid-binding ACT

HEITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDG

Gene3D: G3DSA:3.30.70.260
181-242 no description

ITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDGWSQEETEGLKDALKK

Coil: coil
230-251 coiled-coil

QEETEGLKDALKKEIRKFKDQP

superfamily: SSF56112
IPR011009
264-541 Protein kinase-like (PK-like)
Protein kinase-like domain

DKSTNELLPACVEIPTDGTDEWEIDMKQLKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEML

Gene3D: G3DSA:3.30.200.20
273-354 no description

ACVEIPTDGTDEWEIDMKQLKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIG

ProfileScan: PS50011
IPR000719
292-545 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLI

HMMPfam: PF07714
IPR001245
292-541 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEML

HMMSmart: SM00220
IPR002290
292-545 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLI

HMMSmart: SM00219
IPR020635
292-541 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKIEKKVACGSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEML

Gene3D: G3DSA:1.10.510.10
355-541 no description

ACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEML

FPrintScan: PR00109
IPR001245
366-379 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFMTRGSIYDFLH

FPrintScan: PR00109
IPR001245
403-421 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHQNNIIHRDLKTANLLM

PatternScan: PS00108
IPR008271
409-421 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTANLLM

FPrintScan: PR00109
IPR001245
449-459 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
468-490 TYRKINASE
Serine-threonine/tyrosine-protein kinase

ADVFSYAIVLWELLTGELPYSYL

FPrintScan: PR00109
IPR001245
512-534 TYRKINASE
Serine-threonine/tyrosine-protein kinase

THPKLTELLEKCWQQDPALRPNF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox