PRGDB00066299 (At.32446)

From PRG Wiki
Jump to: navigation, search
At.32446
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145343360 (NM_118459)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT4G23300) mRNA, complete cds

DNA Sequence

GAACGGGTTAGAAACAGATACATGCGTAATTACTAACACAAAGATCACAGCTATAATCTCGTAAGGCAAAATGAAGCAGAGGAGTTTCTTATCAATCCTCTGTTTTATTCTTCTAGCCTTTGGTGTTGCTTCTGTTTCAGCACAAACATGCATAGAGAACCGTAAATATTTCACACCCAACGGTACATACGATTCAAATCGTCGTCTTATCCTCTCTTCTCTTCCTAACAATACCGCCTCTCAAGATGGTTTCTACTACGGTTCGATTGGAGAAGAGCAAGATCGAGTCTACGCATTAGGGATGTGCATCCCAAGATCAACTCCAAGTGACTGTTTTAATTGTATAAAGGGTGCGGCAGGCTGGTTGATACAGGACTGTGTTAACCAGACAGACGCGTATTATTGGGCACTTGATCCAACGCTGTGCCTTGTCCGCTACTCCAACATTTCTTTCTCAGGATCTGCAGCTTTTTGGGAGATTGAGCCTCAGTATTTGGTCTTGAACACTGCAACTATCGCCTCAGATCTAACGGATTTCAAGAACATATGGGAAGACTTAACATCTCGTACGATTACTGCAGCCTCCGCAGCAAGAAGCACACCATCGTCCAGTGATAACCATTACAGAGTTGATTTTGCGAACTTGACAAAATTCCAGAATATCTACGCATTGATGCAATGCACGCCAGATATTTCTTCTGACGAATGTAACAACTGTCTCCAACGAGGCGTACTTGAGTACCAGTCATGCTGTGGAAATAATACTGGAGGCTATGTTATGCGGCCAATCTGCTTTTTCCGGTGGCAGCTTTTTACATTCTCTAAGGCTTTTCATAACATTACCTTGGCTACTCCTCCGAAACCTCCAATGAATGTACCGCGACCACCTTCTGTAGGTCACGGGGCGAACACTACAGATAATGATAGCAGGGGAGTCTCAGCTGGAATTGTAGTGGTGATTACCGTTCCAGCAGTTGTCATCGTCTTGATACTAGTTGTTCTAGGATTTTTTATTTGCTGGAGGAGAAAGTCTTTGCAAAGAACTGAATTTGAATCTGATAGTGATGTTTCTACTACAAATTCATTGCAATACGAGTTTAAGACAATTGAAGCTGCAACGAATAAGTTTTCGAAGAGCAATAAGCTCGGCGAAGGTCGATTTGGGGAAGTTTACAAGGGTAAGTTTTCAAATGGAACTGAAGTTGCCGTGAAGAGGCTCTCGAAAGTATCAGGACAAGACACAAAAAAGTTCAGGAACGAGGCTGTTCTTGTATCAAAAATTCAGCATAGGAATCTGGCTAGGCTTCTTGGGTTCTGTTTGCAAGGAGATGGAAAGTTTTTGATCTATGAGTTTGTTCTCAACAAAAGCCTTGACTATTTTCTATTCGATCCTGAAAAGCAAGGTGAGCTAGACTGGACTCGGCGATACAAGATCATTGGAGGGATTGCTCAAGGGATACTACATCTTCATCAAGATCCACAGCTCACAATCATATATCGTGACTTCAAAGCCAGCAACATTCTCTTAGATGCCGATATGAACCCAAAAATTTCAGATTTTGGAATGGCCACAGTTTTTGGAATGGAGGAAAGTCGAGGCAATACGAACTGGATAGCTGAAACCTTCGTTTACATGTCTCCCGAGTATGCGGTGCATGGCAAATTCTCCATGAAATCTGACGTCTACAGCTTTGGAATCTTGATTCTTGAAATTATTAGCGGCAAGAAGAATAGCAGCCTCTACCAGAACGATGAAACTACTACTGCTGGCAACTTGGTTACCTATGCTTGGAGGCTTTGGAGAAACGGCTCGCAACTAAAGCTGCTGGATTCGTCCATAGGAAGGAACTATCAGAGTAATGAAGTCACTAGATGCATCCATATTGCTCTTTTATGTGTTCAAGAGAATCCAGAAGACCGTCCAAAGTTGTCAACCATTGTCTCAATGCTTACCAGTAACACAATCAGTGTGCCAGCGCCTGGCATACCGGGATTTTTCCCCCAAAGCAGGCGTGAACTGGACCCATTATCTGAGGGATTAGAGTCGGGTTAATATATGAACGAGCAGGTTTTTCCTCATCATGTCTGaaaataaaataaaaacaaaaaaaaTAGCCAGACATCATTTGATTCTCCACAAATAAGGAACATAGTAAGTTTCTCTGAAATTTTAGGCTGTAAACTATACATTATATTCAGTTCAGTAAGAAAATAAGTTTCGGTGAT


Protein sequences

Name Description Sequence
At.32446 translated coding region predicted by ESTScan from UniGene At.32446

XNGLETDTCVITNTKITAIISXGKMKQRSFLSILCFILLAFGVASVSAQTCIENRKYFTPNGTYDSNRRLILSSLPNNTASQDGFYYGSIGEEQDRVYALGMCIPRSTPSDCFNCIKGAAGWLIQDCVNQTDAYYWALDPTLCLVRYSNISFSGSAAFWEIEPQYLVLNTATIASDLTDFKNIWEDLTSRTITAASAARSTPSSSDNHYRVDFANLTKFQNIYALMQCTPDISSDECNNCLQRGVLEYQSCCGNNTGGYVMRPICFFRWQLFTFSKAFHNITLATPPKPPMNVPRPPSVGHGANTTDNDSRGVSAGIVVVITVPAVVIVLILVVLGFFICWRRKSLQRTEFESDSDVSTTNSLQYEFKTIEAATNKFSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSMLTSNTISVPAPGIPGFFPQSRRELDPLSEGLESG

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
46-152 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

VSAQTCIENRKYFTPNGTYDSNRRLILSSLPNNTASQDGFYYGSIGEEQDRVYALGMCIPRSTPSDCFNCIKGAAGWLIQDCVNQTDAYYWALDPTLCLVRYSNISF

HMMPfam: PF01657
IPR002902
49-149 Stress-antifung
Gnk2-homologous domain

QTCIENRKYFTPNGTYDSNRRLILSSLPNNTASQDGFYYGSIGEEQDRVYALGMCIPRSTPSDCFNCIKGAAGWLIQDCVNQTDAYYWALDPTLCLVRYSN

HMMPanther: PTHR24420:SF430
145-673 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VRYSNISFSGSAAFWEIEPQYLVLNTATIASDLTDFKNIWEDLTSRTITAASAARSTPSSSDNHYRVDFANLTKFQNIYALMQCTPDISSDECNNCLQRGVLEYQSCCGNNTGGYVMRPICFFRWQLFTFSKAFHNITLATPPKPPMNVPRPPSVGHGANTTDNDSRGVSAGIVVVITVPAVVIVLILVVLGFFICWRRKSLQRTEFESDSDVSTTNSLQYEFKTIEAATNKFSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSMLTSNTISVPAPGIPGFFPQSRRE

HMMPanther: PTHR24420
145-673 FAMILY NOT NAMED,FAMILY NOT NAMED

VRYSNISFSGSAAFWEIEPQYLVLNTATIASDLTDFKNIWEDLTSRTITAASAARSTPSSSDNHYRVDFANLTKFQNIYALMQCTPDISSDECNNCLQRGVLEYQSCCGNNTGGYVMRPICFFRWQLFTFSKAFHNITLATPPKPPMNVPRPPSVGHGANTTDNDSRGVSAGIVVVITVPAVVIVLILVVLGFFICWRRKSLQRTEFESDSDVSTTNSLQYEFKTIEAATNKFSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSMLTSNTISVPAPGIPGFFPQSRRE

ProfileScan: PS51473
IPR002902
161-274 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

IEPQYLVLNTATIASDLTDFKNIWEDLTSRTITAASAARSTPSSSDNHYRVDFANLTKFQNIYALMQCTPDISSDECNNCLQRGVLEYQSCCGNNTGGYVMRPICFFRWQLFTF

HMMPfam: PF01657
IPR002902
175-271 Stress-antifung
Gnk2-homologous domain

SDLTDFKNIWEDLTSRTITAASAARSTPSSSDNHYRVDFANLTKFQNIYALMQCTPDISSDECNNCLQRGVLEYQSCCGNNTGGYVMRPICFFRWQL

Seg: seg
188-205 seg

TSRTITAASAARSTPSSS

Gene3D: G3DSA:2.60.120.200
IPR013320
273-397 no description
Concanavalin A-like lectin/glucanase, subgroup

TFSKAFHNITLATPPKPPMNVPRPPSVGHGANTTDNDSRGVSAGIVVVITVPAVVIVLILVVLGFFICWRRKSLQRTEFESDSDVSTTNSLQYEFKTIEAATNKFSKSNKLGEGRFGEVYKGKFS

Seg: seg
286-297 seg

PPKPPMNVPRPP

Seg: seg
317-335 seg

IVVVITVPAVVIVLILVVL

superfamily: SSF56112
IPR011009
347-659 Protein kinase-like (PK-like)
Protein kinase-like domain

QRTEFESDSDVSTTNSLQYEFKTIEAATNKFSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSMLTSNTISVP

ProfileScan: PS50011
IPR000719
377-656 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSMLTSNTI

HMMSmart: SM00219
IPR020635
377-651 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSML

HMMSmart: SM00220
IPR002290
377-651 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSML

HMMPfam: PF07714
IPR001245
379-651 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFVLNKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSML

PatternScan: PS00107
IPR017441
383-405 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGRFGEVYKGKFSNGTEVAVK

Gene3D: G3DSA:3.30.200.20
398-453 no description

NGTEVAVKRLSKVSGQDTKKFRNEAVLVSKIQHRNLARLLGFCLQGDGKFLIYEFV

Gene3D: G3DSA:1.10.510.10
455-651 no description

NKSLDYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKISDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKNSSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEVTRCIHIALLCVQENPEDRPKLSTIVSML

PatternScan: PS00108
IPR008271
498-510 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox