PRGDB00066305 (At.32505)

From PRG Wiki
Jump to: navigation, search
At.32505
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145341904 (NM_118399)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat transmembrane protein kinase, putative (AT4G22730) mRNA, complete cds

DNA Sequence

ATTCACGAGAGTGGAAGGTTACAGTTTTCCAAATCCGAGAAACAGACACAAAATTGGTCCCTCTCTAAAAGTTACTATCTTCGTTTAACAAAGAGATAGCTCCCAATCCAGTACAAAACAGAGTACTCTGCTCTATAAATTTCGTTCCTTTATTACTCTGCTCTATAAAACAGATTATTCTGCTCTATAAGAGAGATAGATAAATGAGCTAAAGCTCAGTAATTTCTAAACAGAGAGACAAGAAAATTCAAGAATGGTTACCTTATGTGCCACGTTACTGATCCTTCTCTCAATCTTTCTTGCAACTCCGTCGAATGTTCGAGGAAATGCAGAGCTGAAGGCTTTAATGGAGCTGAAATCGTCGCTTGACCCTGAAAACAAGCTTCTCCGTTCATGGACGTTTAACGGCGATCCATGCGACGGATCTTTCGAAGGAATTGCATGTAACCAGCATCTAAAAGTCGCAAACATATCATTACAAGGGAAACGTTTGGTCGGAAAATTGTCTCCGGCGGTTGCAGAGCTCAAATGTTTGTCAGGTCTTTACTTACATTACAATAGTCTCTCTGGAGAGATACCTCAAGAGATCACAAATCTTACTGAATTATCAGATCTTTATCTCAATGTTAATAACTTCTCTGGTGAGATTCCGGCAGATATCGGCTCCATGGCTGGCTTGCAAGTTATGGATCTTTGTTGCAACAGTTTAACAGGGAAGATACCAAAGAACATTGGATCCTTGAAGAAACTTAATGTGTTGTCTCTGCAACACAACAAACTAACCGGAGAGGTTCCTTGGACTTTAGGAAACTTGAGTATGTTAAGCAGGCTTGATTTAAGCTTCAACAATCTGTTAGGTTTAATCCCAAAAACCCTAGCCAACATTCCTCAGTTGGACACTCTTGACTTGCGCAACAATACTCTCTCTGGCTTTGTTCCTCCTGGTCTTAAGAAGTTGAATGGGAGCTTCCAGTTTGAGAACAACACCGGGTTATGTGGTATCGATTTTCCTTCTTTGAGAGCTTGTTCTGCTTTCGATAATGCGAATAATATCGAACAATTTAAGCAGCCTCCTGGTGAAATAGACACTGATAAATCAGCTCTTCACAACATTCCCGAGTCTGTATATCTCCAAAAGCATTGCAACCAAACACATTGCAAGAAATCCTCATCGAAACTCCCACAAGTTGCTTTGATTTCAAGCGTGATTACCGTCACTATAACATTGATTGGTGCTGGTATATTGACCTTCTTTCGCTACAGAAGAAGGAAGCAAAAGATCAGTAACACACCTGAGTTTTCCGAGGGAAGACTAAGCACAGATCAACAAAAAGAGTTCCGTGCATCGCCTTTAGTGAGTCTTGCCTACACTAAAGAATGGGATCCGCTAGGTGATAGCAGAAACGGAGCTGAGTTTTCACAAGAGCCTCATCTCTTTGTTGTAAATAGTAGCTTCAGGTTTAACTTAGAAGACATTGAATCAGCAACCCAATGCTTCTCAGAAGCTAATCTATTGAGCAGAAACAGCTTCACCTCAGTGTTCAAAGGAGTCCTCAGAGATGGTTCTCCGGTAGCTATCAGAAGCATCAACATAAGCAGTTGCAAGAACGAAGAAGTCGAATTCATGAACGGTTTAAAGCTTTTATCTTCGTTGTCACACGAAAACTTAGTGAAGCTACGTGGATTCTGCTGTTCTAGAGGCAGAGGAGAGTGTTTCCTCATCTATGATTTTGCTTCAAAAGGAAAGCTTTCAAATTTTCTTGACTTACAAGAACGCGAAACTAATCTGGTCCTTGCTTGGTCTGCAAGAATCTCCATCATCAAAGGGATTGCAAAAGGTATTGCTTACTTACATGGAAGTGATCAACAGAAGAAGCCTACAATAGTTCATCGAAACATCTCTGTCGAAAAAATCCTACTTGATGAACAATTTAACCCGTTAATCGCTGATTCGGGTCTTCACAACCTTCTAGCAGACGATATGGTCTTCTCAGCACTCAAAACAAGTGCAGCAATGGGATATTTAGCTCCGGAATACGTCACAACCGGAAAATTCACCGAGAAAACCGATATTTTCGCCTTTGGAGTCATCATTCTCCAGATACTCTCTGGTAAGCTCATGCTTACAAGTTCACTGAGAAATGCAGCTGAAAATGGAGAACATAACGGGTTCATCGATGAAGATCTTCGTGAAGAGTTTGATAAACCAGAGGCGACTGCAATGGCGAGGATTGGGATAAGCTGTACACAGGAGATACCAAACAATAGGCCTAATATAGAGACATTGCTTGAGAATATAAACTGTATGAAGAGTGAATGACTCTGCTTTTTAATTAGTATCTTTGTGCAAGTATGATTCTCCGGTTAGCTGTGTCCCACCAATTGGTTTTGTTTGTTTTAGTTCTCTCCAGTAAGAACCGGGTCCGGTTTATATTTTATTTAGATTTGTAGCTGAGAATTGAAGCTTTAATCAGTTAGCTATATGATTATAAGCAACGAAGAACTGATT


Protein sequences

Name Description Sequence
At.32505 translated coding region predicted by ESTScan from UniGene At.32505

MVTLCATLLILLSIFLATPSNVRGNAELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACNQHLKVANISLQGKRLVGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPADIGSMAGLQVMDLCCNSLTGKIPKNIGSLKKLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLNGSFQFENNTGLCGIDFPSLRACSAFDNANNIEQFKQPPGEIDTDKSALHNIPESVYLQKHCNQTHCKKSSSKLPQVALISSVITVTITLIGAGILTFFRYRRRKQKISNTPEFSEGRLSTDQQKEFRASPLVSLAYTKEWDPLGDSRNGAEFSQEPHLFVVNSSFRFNLEDIESATQCFSEANLLSRNSFTSVFKGVLRDGSPVAIRSINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLENINCMKSE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-683 PTHR24420,FAMILY NOT NAMED

MVTLCATLLILLSIFLATPSNVRGNAELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACNQHLKVANISLQGKRLVGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPADIGSMAGLQVMDLCCNSLTGKIPKNIGSLKKLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLNGSFQFENNTGLCGIDFPSLRACSAFDNANNIEQFKQPPGEIDTDKSALHNIPESVYLQKHCNQTHCKKSSSKLPQVALISSVITVTITLIGAGILTFFRYRRRKQKISNTPEFSEGRLSTDQQKEFRASPLVSLAYTKEWDPLGDSRNGAEFSQEPHLFVVNSSFRFNLEDIESATQCFSEANLLSRNSFTSVFKGVLRDGSPVAIRSINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLENIN

superfamily: SSF52058
21-256 SSF52058,LRR

NVRGNAELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACNQHLKVANISLQGKRLVGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPADIGSMAGLQVMDLCCNSLTGKIPKNIGSLKKLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLNGSFQFENNTGLCGIDFPSLR

HMMPfam: PF08263
IPR013210
25-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NAELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACN

Gene3D: G3DSA:3.80.10.10
26-260 G3DSA:3.80.10.10

AELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACNQHLKVANISLQGKRLVGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTELSDLYLNVNNFSGEIPADIGSMAGLQVMDLCCNSLTGKIPKNIGSLKKLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLNGSFQFENNTGLCGIDFPSLRACSA

HMMPfam: PF00560
IPR001611
142-163 LRR_1
Leucine-rich repeat

LQVMDLCCNSLTGKIPKNIGSL

HMMPfam: PF13855
165-223 LRR_8,Leucine rich repeat

KLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNT

superfamily: SSF56112
IPR011009
387-682 Kinase_like
Protein kinase-like domain

EFSQEPHLFVVNSSFRFNLEDIESATQCFSEANLLSRNSFTSVFKGVLRDGSPVAIRSINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLENI

Gene3D: G3DSA:3.30.200.20
402-493 G3DSA:3.30.200.20

RFNLEDIESATQCFSEANLLSRNSFTSVFKGVLRDGSPVAIRSINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDF

ProfileScan: PS50011
IPR000719
415-688 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEANLLSRNSFTSVFKGVLRDGSPVAIRSINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLENINCMKSE

HMMPfam: PF07714
IPR001245
420-681 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LLSRNSFTSVFKGVLRDGSPVAIRSINISSCKNEEVEFMNGLKLLSSLSHENLVKLRGFCCSRGRGECFLIYDFASKGKLSNFLDLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLEN

Gene3D: G3DSA:1.10.510.10
494-684 G3DSA:1.10.510.10

ASKGKLSNFLDLQERETNLVLAWSARISIIKGIAKGIAYLHGSDQQKKPTIVHRNISVEKILLDEQFNPLIADSGLHNLLADDMVFSALKTSAAMGYLAPEYVTTGKFTEKTDIFAFGVIILQILSGKLMLTSSLRNAAENGEHNGFIDEDLREEFDKPEATAMARIGISCTQEIPNNRPNIETLLENINC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox