PRGDB00066307 (At.32633)

From PRG Wiki
Jump to: navigation, search
At.32633
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 110738231 (AK229175)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana mRNA for serine

DNA Sequence

ACTGTTCCTCTGTTTCTCTTCTTTCATCTTTAAGCAAACCTCAAAAACCAATCCTTTATTACGAAGATCCTCACTTGTGTCTTCTTCTCCAACACTAAACCCCAAGAAAATGAGATTCTTCCGCAAAACCTcactttatctttctctcttcttatacttctttctttatgaatcttcCATGGCTGCAAATACAATCAGAAGAGGCGAATCTTTAAGAGACGGAATCAATCACAAACCTTTAGTCTCTCCACAAAAGACATTCGAGCTAGGTTTCTTCAGTCCTGGAAGCTCTACGCATCGTTTCCTAGGGATTTGGTATGGGAACATCGAGGATAAAGCTGTGGTATGGGTAGCAAACAGAGCAACTCCAATTTCAGACCAATCTGGAGTTCTCATGATAAGCAACGATGGTAATCTCGTGTTATTAGACGGGAAGAACATCACTGTCTGGTCTTCAAACATCGAGTCAAGCACTACCAACAACAACAACAGAGTCGTTTCTATACATGACACTGGGAACTTTGTTTTGTCTGAAACCGACACAGATAGACCTATTTGGGAGAGTTTCAATCACCCAACAGATACCTTCTTACCGCAGATGAGAGTTCGTGTGAATCCACAAACCGGAGACAATCACGCTTTTGTCTCATGGAGATCTGAGACTGATCCTTCCCCTGGTAATTACTCATTAGGGGTTGATCCCTCTGGAGCACCAGAGATTGTGCTTTGGGAAGGGAACAAGACGAGGAAATGGAGAAGCGGGCAATGGAACTCTGCGATTTTTACCGGGATTCCGAATATGTCTCTGTTGACGAATTATCTTTACGGATTCAAGCTTTCATCTCCTCCAGATGAAACAGGTAGCGTGTACTTCACGTATGTTCCTTCAGATCCATCAGTGTTACTTAGGTTTAAGGTTCTTTATAATGGAACCGAAGAGGAATTGAGATGGAATGAGACTTTGAAGAAGTGGACTAAGTTTCAGTCTGAGCCAGATAGTGAGTGTGATCAGTATAATCGTTGTGGCAAGTTTGGTATTTGTGATATGAAGGGCTCTAATGGAATCTGTAGCTGTATTCATGGTTATGAGCAAGTTTCTGTTGGGAATTGGAGTAGAGGTTGTAGAAGAAGAACACCGTTGAAGTGTGAAAGGAACATTAGTGTTGGAGAGGATGAGTTCTTGACTTTGAAATCTGTGAAGTTGCCTGATTTTGAAATTCCTGAACATAATCTTGTTGATCCTGAGGATTGCAGAGAGAGGTGTCTGAGGAATTGTTCTTGCAATGCTTATTCTCTTGTTGGTGGTATTGGATGCATGATTTGGAACCAAGATTTAGTGGATTTACAACAGTTTGAAGCTGGTGGTTCTTCGCTTCATATCCGTCTTGCTGATTCCGAAGTAGGGGAGAACAGGAAAACAAAGATTGCAGTGATTGTCGCGGTTCTTGTTGGTGTGATCTTGATAGGAATCTTTGCTCTGCTTCTATGGAGATTCAAGAGAAAGAAAGATGTTTCAGGAGCATATTGTGGTAAGAACACCGATACATCGGTTGTTGTTGCTGATCTGACCAAGAGCAAAGAAACTACTTCAGCGTTTTCAGGATCAGTAGACATAATGATTGAAGGGAAAGCTGTTAACACATCCGAGTTACCTGTCTTTTCTCTGAATGCTATAGCCATAGCTACTAATGATTTCTGCAAAGAAAATGAGCTTGGAAGAGGTGGATTCGGACCAGTCTACAAGGGTGTTCTCGAAGATGGACGTGAGATAGCTGTGAAGAGATTGTCTGGTAAATCAGGACAAGGAGTTGATGAATTCAAGAATGAGATTATTCTCATAGCGAAGCTTCAACATCGGAATCTTGTGAGATTACTTGGATGTTGCTTCGAGGGAGAAGAGAAAATGCTTGTTTATGAGTATATGCCTAACAAGAGCTTGGATTTCTTCCTCTTTGATGAAACGAAACAAGCGTTGATAGACTGGAAACTGCGGTTTTCGATAATTGAAGGGATTGCGAGAGGATTGCTTTATCTTCATAGAGATTCAAGATTGAGAATCATTCATAGAGACTTGAAGGTTAGCAATGTGTTGTTAGATGCAGAGATGAATCCAAAGATCTCAGATTTTGGTATGGCAAGGATCTTTGGTGGTAACCAAAATGAAGCTAACACGGTTCGCGTTGTTGGAACTTACGGATACATGTCTCCTGAATACGCGATGGAAGGACTTTTCTCGGTGAAATCCGATGTTTACAGCTTCGGTGTCTTGTTGCTAGAGATTGTAAGTGGGAAGAGGAACACAAGTCTTCGATCTTCTGAACATGGAAGTCTCATTGGTTATGCTTGGTATTTGTATACTCATGGGAGATCAGAGGAGCTTGTGGATCCTAAGATCAGGGTCACATGCAGTAAGCGAGAGGCCTTGAGATGCATACACGTAGCGATGCTATGTGTTCAAGATTCGGCTGCGGAGAGACCCAACATGGCTTCAGCTTTGCTTATGTTAGAGAGTGACACAGCGACGCTCGCTGCGCCTAGACAACCAACGTTTACTTCCACCAGAAGAAACTCCATTGATGTCAACTTTGCTCTTGATTCGAGCCAACAATACATCGTTTCTTCTAATGAGATCACTTCAACGGTTGTTCTTGGACGATAAGATTCTTTTGTTTGTTCTTTTGTAAAGtttttttttATATAATTGTTGTGAAAACGTATAATATTTTTTGGTTAATTAGGATAATGGAGTAATGGTTGTTGAAGAAAAAAA


Protein sequences

Name Description Sequence
At.32633 translated coding region predicted by ESTScan from UniGene At.32633

MAANTIRRGESLRDGINHKPLVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGAPEIVLWEGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDPSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGICSCIHGYEQVSVGNWSRGCRRRTPLKCERNISVGEDEFLTLKSVKLPDFEIPEHNLVDPEDCRERCLRNCSCNAYSLVGGIGCMIWNQDLVDLQQFEAGGSSLHIRLADSEVGENRKTKIAVIVAVLVGVILIGIFALLLWRFKRKKDVSGAYCGKNTDTSVVVADLTKSKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASALLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVLGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
1-130 BULB_LECTIN
Bulb-type lectin domain

MAANTIRRGESLRDGINHKPLVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESF

HMMSmart: SM00108
IPR001480
12-133 Bulb-type mannose-specific lectin
Bulb-type lectin domain

LRDGINHKPLVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESFNHP

HMMPanther: PTHR24420:SF771
21-824 B120; PROTEIN KINASE/ SUGAR BINDING

LVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGAPEIVLWEGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDPSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGICSCIHGYEQVSVGNWSRGCRRRTPLKCERNISVGEDEFLTLKSVKLPDFEIPEHNLVDPEDCRERCLRNCSCNAYSLVGGIGCMIWNQDLVDLQQFEAGGSSLHIRLADSEVGENRKTKIAVIVAVLVGVILIGIFALLLWRFKRKKDVSGAYCGKNTDTSVVVADLTKSKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASALLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVL

HMMPanther: PTHR24420
21-824 FAMILY NOT NAMED,FAMILY NOT NAMED

LVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGAPEIVLWEGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDPSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGICSCIHGYEQVSVGNWSRGCRRRTPLKCERNISVGEDEFLTLKSVKLPDFEIPEHNLVDPEDCRERCLRNCSCNAYSLVGGIGCMIWNQDLVDLQQFEAGGSSLHIRLADSEVGENRKTKIAVIVAVLVGVILIGIFALLLWRFKRKKDVSGAYCGKNTDTSVVVADLTKSKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASALLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVL

superfamily: SSF51110
IPR001480
43-164 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGIWYGNIEDKAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDP

HMMPfam: PF01453
IPR001480
53-165 B_lectin
Bulb-type lectin domain

KAVVWVANRATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETDTDRPIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPS

Seg: seg
92-104 seg

SSNIESSTTNNNN

Gene3D: G3DSA:2.90.10.10
IPR001480
166-203 no description
Bulb-type lectin domain

PGNYSLGVDPSGAPEIVLWEGNKTRKWRSGQWNSAIFT

HMMPfam: PF00954
IPR000858
192-305 S_locus_glycop
S-locus glycoprotein

WRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDPSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGICSCIHGYEQ

ProfileScan: PS50948
IPR003609
323-404 PAN
Apple-like

CERNISVGEDEFLTLKSVKLPDFEIPEHNLVDPEDCRERCLRNCSCNAYSLVGGIGCMIWNQDLVDLQQFEAGGSSLHIRLA

HMMPfam: PF08276
IPR013227
329-389 PAN_2
PAN-2 domain

VGEDEFLTLKSVKLPDFEIPEHNLVDPEDCRERCLRNCSCNAYSLVGGIGCMIWNQDLVDL

HMMSmart: SM00473
IPR003609
329-403 divergent subfamily of APPLE domains
Apple-like

VGEDEFLTLKSVKLPDFEIPEHNLVDPEDCRERCLRNCSCNAYSLVGGIGCMIWNQDLVDLQQFEAGGSSLHIRL

Seg: seg
416-436 seg

IAVIVAVLVGVILIGIFALLL

Gene3D: G3DSA:3.30.200.20
487-568 no description

NTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGC

superfamily: SSF56112
IPR011009
492-807 Protein kinase-like (PK-like)
Protein kinase-like domain

PVFSLNAIAIATNDFCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASALLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDS

ProfileScan: PS50011
IPR000719
506-791 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASALLMLESDTATLAAPRQPTF

HMMSmart: SM00219
IPR020635
506-776 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASALLML

HMMSmart: SM00220
IPR002290
506-752 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FCKENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCI

HMMPfam: PF07714
IPR001245
509-771 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMAS

Gene3D: G3DSA:1.10.510.10
569-773 no description

CFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAERPNMASAL

PatternScan: PS00108
IPR008271
627-639 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKVSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox