PRGDB00066308 (At.32634)

From PRG Wiki
Jump to: navigation, search
At.32634
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30685418 (NM_118258)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ARK3 (A. THALIANA RECEPTOR KINASE 3); kinase

DNA Sequence

ATATATTATTGACAGAAATAAAATCGGTTACGTAAGGTTCACACATTACACAAAACATGTCCGATATCTCCAATGGAAATAAACTCTCATACTTTTCTCAAGAAAGAGTGaaaaacaaaaaacttggtttagagaaatgagaggtttaccaaatttctaccattcttacaccttcttcttcttcttcctcttaattctgttccctgcttactctATCTCTGCCAACACTTTGTCGGCTTCAGAATCTCTAACTATCTCAAGCAATAACACCATTGTGTCTCCTGGTAATGTCTTCGAGCTTGGTTTCTTCAAACCCGGTTTAGATTCTCGTTGGTATCTTGGAATTTGGTACAAGGCAATCTCTAAGAGAACCTACGTATGGGTTGCAAACAGAGACACTCCTCTCTCTAGTTCCATCGGAACTCTCAAAATCTCCGACAGTAATCTTGTCGTTTTGGATCAGTCCGATACACCGGTTTGGTCGACGAATCTGACCGGAGGAGATGTGAGATCTCCATTGGTGGCAGAGCTTCTTGATAATGGTAATTTTGTGCTCAGAGACTCCAAGAACAGCGCTCCAGATGGAGTTTTGTGGCAGAGTTTTGATTTTCCGACAGATACTTTACTTCCGGAGATGAAACTTGGCTGGGATGCCAAAACCGGGTTCAACAGATTCATTAGATCATGGAAATCTCCAGATGATCCATCAAGTGGAGATTTCTCGTTCAAACTCGAAACCGAAGGCTTCCCTGAGATTTTTCTATGGAACAGAGAATCACGAATGTACCGGAGTGGTCCATGGAATGGAATCCGGTTTAGTGGTGTACCGGAGATGCAACCATTTGAATACATGGTTTTCAATTTCACTACGAGTAAAGAAGAAGTGACTTACTCATTTAGAATCACTAAAAGCGACGTTTACTCGAGATTAAGCATAAGCTCCTCAGGATTGTTACAAAGATTCACTTGGATTGAGACAGCACAGAATTGGAACCAATTCTGGTACGCACCAAAAGACCAATGTGATGAGTACAAAGAGTGTGGTGTTTACGGTTATTGCGACTCGAACACTTCACCTGTTTGTAATTGTATTAAAGGGTTTAAGCCGAGGAATCCTCAAGTGTGGGGATTGAGAGACGGGTCGGATGGTTGCGTGAGGAAGACGCTACTGAGCTGTGGTGGCGGAGATGGGTTTGTGCGGTTGAAGAAAATGAAATTGCCGGATACTACCACGGCTAGTGTGGACAGAGGAATTGGTGTGAAAGAATGTGAACAGAAGTGTTTAAGAGATTGTAATTGCACGGCGTTTGCGAATACGGATATCCGGGGTAGCGGGTCGGGTTGTGTGACTTGGACCGGAGAGCTTTTTGATATCAGGAATTATGCCAAAGGTGGTCAAGATCTTTACGTTAGATTGGCTGCTACTGATCTCGAGGACAAAAGAAACAGAAGTGCAAAAATCATAGGTTCGAGTATTGGAGTGAGCGTTTTGCTTCTTTTAAGTTTCATTATCTTCTTCTTGTGGAAAAGGAAGCAGAAGCGATCAATACTAATCGAAACACCTATTGTTGATCATCAACTGAGAAGCCGAGATTTGCTAATGAACGAAGTTGTAATATCAAGTAGGAGACACATATCTAGAGAAAACAATACAGACGATCTCGAATTGCCATTGATGGAGTTTGAAGAAGTTGCCATGGCCACAAACAATTTTTCTAACGCCAACAAGCTAGGACAAGGTGGTTTTGGTATAGTTTATAAGGGAAAGTTACTTGATGGTCAAGAAATGGCAGTGAAGAGACTATCAAAGACATCAGTTCAGGGGACTGATGAGTTCAAGAATGAGGTAAAGTTGATTGCAAGGCTTCAGCACATAAACCTTGTTAGGCTTCTTGCATGTTGCGTCGATGCGGGTGAGAAGATGTTGATTTACGAGTACTTGGAAAATCTAAGCCTCGACTCTCATCTATTTGACAAATCCCGAAACTCTAAGCTAAATTGGCAAATGAGATTTGATATCATCAATGGTATTGCTCGAGGACTTCTATATCTTCACCAAGATTCACGGTTTAGAATTATCCATAGAGACTTGAAAGCAAGTAACATCTTGCTTGATAAATATATGACTCCAAAGATCTCGGATTTCGGAATGGCTAGGATCTTTGGACGGGATGAGACAGAAGCTAATACGAGGAAGGTGGTTGGAACCTACGGTTATATGTCTCCTGAATATGCAATGGACGGGATATTCTCGATGAAGTCAGATGTTTTCAGTTTTGGGGTCTTGCTTCTTGAGATTATAAGTAGCAAGAGGAACAAAGGATTCTACAATTCGGACCGTGACCTTAACCTTCTCGGTTGTGTGTGGAGGAATTGGAAAGAAGGAAAAGGGCTAGAGATCATAGATCCAATCATCACAGATTCTTCATCAACATTCAGGCAACATGAAATCTTAAGATGCATACAAATTGGCCTCTTGTGTGTTCAAGAACGTGCAGAGGACAGACCAACTATGTCCTTGGTAATTTTGATGCTCGGAAGCGAATCAACAACTATTCCTCAACCTAAAGCGCCCGGTTATTGCCTGGAGAGAAGTCTTCTTGACACTGATTCTTCGTCGAGTAAACAGCGCGACGATGAATCATGGACAGTGAACCAAATTACTGTCTCGGTCCTTGATGCTCGGTAATGTGACTGTCAACTAGCCAATCTTCTATACTAAGATGACTAAATTGAGCGACAATAAGAATCAACTAGGAAAGATGGTATTAGTTATGTGCATAGTATTTTCTCTGTACGTCTCCGTTGCAAAGGTTACTACATGATTCAATTGTCTTAATTAAGCATGTATTCTGTAATTGCTTTATGGATAACCCAAATAGTCCTGCAGTTATAGGACATCAATGTGATATTTTGAAAGATTCTCAGACTTTCATATTATAAATTATGGCTACTAGAAGAGGCAAATATTGTTGGTTAGTAG


Protein sequences

Name Description Sequence
At.32634 translated coding region predicted by ESTScan from UniGene At.32634

MRGLPNFYHSYTFFFFFLLILFPAYSISANTLSASESLTISSNNTIVSPGNVFELGFFKPGLDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRFTWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSDGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDIRNYAKGGQDLYVRLAATDLEDKRNRSAKIIGSSIGVSVLLLLSFIIFFLWKRKQKRSILIETPIVDHQLRSRDLLMNEVVISSRRHISRENNTDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF432
1-850 PTHR24420:SF432,SUBFAMILY NOT NAMED

MRGLPNFYHSYTFFFFFLLILFPAYSISANTLSASESLTISSNNTIVSPGNVFELGFFKPGLDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRFTWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSDGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDIRNYAKGGQDLYVRLAATDLEDKRNRSAKIIGSSIGVSVLLLLSFIIFFLWKRKQKRSILIETPIVDHQLRSRDLLMNEVVISSRRHISRENNTDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR

HMMPanther: PTHR24420
1-850 PTHR24420,FAMILY NOT NAMED

MRGLPNFYHSYTFFFFFLLILFPAYSISANTLSASESLTISSNNTIVSPGNVFELGFFKPGLDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRFTWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSDGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDIRNYAKGGQDLYVRLAATDLEDKRNRSAKIIGSSIGVSVLLLLSFIIFFLWKRKQKRSILIETPIVDHQLRSRDLLMNEVVISSRRHISRENNTDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR

HMMPIR: PIRSF000641
IPR024171
9-850 SRK
S-receptor-like serine/threonine-protein kinase

HSYTFFFFFLLILFPAYSISANTLSASESLTISSNNTIVSPGNVFELGFFKPGLDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRFTWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSDGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDIRNYAKGGQDLYVRLAATDLEDKRNRSAKIIGSSIGVSVLLLLSFIIFFLWKRKQKRSILIETPIVDHQLRSRDLLMNEVVISSRRHISRENNTDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR

ProfileScan: PS50927
IPR001480
31-153 BULB_LECTIN
Bulb-type lectin domain

TLSASESLTISSNNTIVSPGNVFELGFFKPGLDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLW

HMMSmart: SM00108
IPR001480
37-159 B_lectin
Bulb-type lectin domain

SLTISSNNTIVSPGNVFELGFFKPGLDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFP

superfamily: SSF51110
IPR001480
62-224 B_lectin
Bulb-type lectin domain

LDSRWYLGIWYKAISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYRSGPWNG

Gene3D: G3DSA:2.90.10.10
IPR001480
75-161 Bulb-type_lectin_dom
Bulb-type lectin domain

ISKRTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTD

HMMPfam: PF01453
IPR001480
78-191 B_lectin
Bulb-type lectin domain

RTYVWVANRDTPLSSSIGTLKISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
193-229 Bulb-type_lectin_dom
Bulb-type lectin domain

GDFSFKLETEGFPEIFLWNRESRMYRSGPWNGIRFSG

HMMPfam: PF00954
IPR000858
217-326 S_locus_glycop
S-locus glycoprotein

YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRFTWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRN

ProfileScan: PS50948
IPR003609
347-428 PAN
Apple-like

CGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDIRNYAKGGQDLYVRLA

HMMPfam: PF08276
IPR013227
347-413 PAN_2
PAN-2 domain

CGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDI

HMMSmart: SM00473
IPR003609
348-427 PAN_AP
Apple-like

GGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDIRGSGSGCVTWTGELFDIRNYAKGGQDLYVRL

HMMPfam: PF12398
IPR022126
474-516 DUF3660
S-locus, receptor kinase

ETPIVDHQLRSRDLLMNEVVISSRRHISRENNTDDLELPLMEF

Gene3D: G3DSA:3.30.200.20
512-601 G3DSA:3.30.200.20

PLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEY

superfamily: SSF56112
IPR011009
512-831 Kinase_like
Protein kinase-like domain

PLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTIPQPKAPGYCLERSLLDTDSSSSKQ

ProfileScan: PS50011
IPR000719
526-807 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTI

HMMPfam: PF07714
IPR001245
529-797 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVI

PatternScan: PS00107
IPR017441
532-554 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGIVYKGKLLDGQEMAVK

Gene3D: G3DSA:1.10.510.10
602-799 G3DSA:1.10.510.10

LENLSLDSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILM

PatternScan: PS00108
IPR008271
647-659 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL

HMMPfam: PF11883
IPR021820
802-850 DUF3403
S-locus receptor kinase, C-terminal

SESTTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox