PRGDB00066311 (At.32731)

From PRG Wiki
Jump to: navigation, search
At.32731
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145340447 (NM_118146)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana BAM3 (BARELY ANY MERISTEM 3); ATP binding

DNA Sequence

CCCAAAACATTAAAGCATGATGATGTCTAATGATGATGATCTTCTTCGTTCCATTTCTCTAAATTTTTGGGATTTCTGCGAAGACCcttcttctctttctcttctctgaacttcaagattcgtgtcggacaaatttttgtttttatttttctgatgttacaatggcagacaagatcttcactttcttcctaatcttgtcttcgatctctcctctcttatgctcttctttgatctcacctctTAATCTCTCACTTATTAGACAAGCAAATGTCCTTATCTCTCTAAAGCAAAGTTTTGATTCCTATGATCCTTCTCTTGATTCATGGAACATTCCAAATTTCAACTCTCTATGTTCTTGGACTGGTGTTTCTTGTGACAACTTGAATCAGTCTATTACTCGTCTAGACCTATCTAATCTCAACATCTCCGGCACTATCTCTCCGGAAATATCTCGTCTTTCGCCGTCACTTGTTTTTCTTGACATTTCTTCTAACAGTTTCTCCGGTGAGCTTCCTAAAGAGATCTATGAGCTCTCAGGCCTCGAAGTGTTAAACATCTCTAGCAATGTTTTTGAAGGAGAGCTGGAGACACGTGGGTTCAGTCAAATGACTCAGCTTGTGACTCTTGACGCTTACGACAACAGCTTCAACGGATCACTTCCTCTGAGTCTAACCACACTCACTCGTCTCGAGCACTTAGATCTTGGAGGAAACTACTTCGACGGTGAGATCCCTAGAAGCTATGGAAGTTTCTTGAGTCTCAAGTTTCTTTCTTTATCTGGTAATGATCTCCGTGGGAGAATCCCTAACGAGCTAGCGAACATCACGACTTTGGTACAGCTTTACTTAGGTTACTACAACGATTACCGCGGTGGGATACCTGCAGATTTCGGGAGATTGATCAATCTTGTTCATTTGGATTTAGCTAATTGCAGCTTGAAAGGATCAATTCCTGCAGAATTGGGGAATCTCAAGAACTTGGAGGTTCTGTTTCTTCAGACCAATGAGCTTACAGGCTCTGTTCCTCGAGAGTTAGGGAACATGACAAGCCTCAAGACTCTTGATCTCTCCAACAACTTTCTTGAAGGAGAGATTCCTCTAGAGCTATCTGGACTTCAAAAGCTTCAGTTGTTTAACCTCTTCTTCAACAGACTACACGGCGAGATCCCTGAGTTCGTATCTGAGCTTCCTGATCTGCAAATACTCAAGCTTTGGCACAACAATTTCACCGGAAAGATTCCTTCGAAACTCGGATCAAACGGGAACTTGATCGAGATCGATTTGTCTACCAATAAACTCACAGGTTTGATCCCTGAGTCACTCTGTTTCGGAAGAAGACTAAAGATTCTCATTCTCTTCAACAACTTCTTGTTCGGTCCTCTCCCTGAAGATCTTGGCCAATGTGAACCGCTATGGAGATTCCGTCTCGGACAGAACTTTCTGACAAGTAAGTTGCCAAAGGGTTTGATTTATTTGCCGAATCTTTCGCTTCTTGAGCTTCAAAACAACTTTTTGACTGGAGAAATCCCCGAAGAAGAGGCGGGAAATGCGCAGTTTTCGAGCCTTACTCAGATCAATCTGTCCAACAACAGGTTATCCGGACCGATTCCTGGTTCAATCAGAAACCTCAGAAGCCTTCAGATTCTTCTTCTCGGTGCAAACCGGTTATCGGGACAGATCCCTGGCGAAATCGGAAGTTTGAAGAGTCTTCTCAAGATTGACATGAGCAGAAACAACTTCTCAGGCAAGTTTCCTCCTGAGTTTGGTGATTGCATGTCACTCACATATTTAGATTTGAGTCACAACCAGATTTCCGGTCAGATTCCGGTTCAGATATCGCAGATTCGGATTCTAAACTATCTGAATGTTTCTTGGAATTCCTTTAACCAAAGCCTTCCCAACGAACTCGGATACATGAAGAGTTTAACATCAGCAGATTTCTCACACAACAACTTCTCCGGTTCAGTACCAACTTCAGGGCAATTCTCTTACTTCAACAACACGTCATTCCTTGGAAACCCTTTTCTCTGTGGATTTTCTTCAAACCCTTGCAACGGTTCCCAAAACCAATCTCAATCTCAGCTACTTAACCAGAACAACGCAAGATCCCGAGGTGAAATCTCCGCAAAATTCAAGTTGTTCTTCGGGTTAGGCCTACTAGGGTTTTTCTTGGTGTTCGTCGTTTTAGCTGTGGTCAAGAATAGGAGAATGAGAAAGAACAACCCGAATTTATGGAAGCTTATAGGGTTTCAGAAGCTCGGTTTCAGAAGCGAACACATATTAGAATGTGTTAAAGAGAACCATGTGATTGGGAAAGGCGGACGAGGGATTGTCTACAAAGGGGTAATGCCAAACGGAGAAGAAGTTGCAGTCAAGAAGCTCTTAACCATAACCAAAGGATCATCTCATGACAACGGTTTAGCCGCAGAGATTCAGACATTAGGTAGAATCAGACACAGAAACATAGTGAGATTGCTCGCTTTTTGTTCAAACAAAGACGTGAATCTCCTTGTTTACGAGTATATGCCTAATGGTAGCCTCGGAGAAGTCTTGCACGGGAAAGCTGGAGTGTTTTTGAAATGGGAAACACGGTTGCAAATAGCGTTGGAAGCGGCTAAGGGGTTGTGTTATCTTCACCATGATTGCTCGCCACTTATAATCCACCGTGATGTGAAGTCAAACAACATCTTGTTGGGTCCTGAGTTTGAAGCTCATGTTGCTGATTTTGGGCTTGCTAAGTTTATGATGCAAGACAATGGAGCTTCCGAGTGCATGTCCTCGATCGCTGGCTCGTACGGCTACATCGCTCCAGAATATGCATATACACTGAGAATAGACGAGAAGAGCGATGTGTACAGCTTCGGAGTAGTGTTATTGGAGCTGATTACGGGTCGAAAACCAGTAGATAATTTTGGGGAAGAAGGGATAGACATTGTGCAATGGTCAAAGATCCAAACAAACTGTAACAGACAAGGTGTGGTGAAGATCATTGACCAGAGATTGAGCAATATTCCATTAGCAGAGGCCATGGAACTGTTCTTTGTGGCAATGCTATGTGTGCAAGAACATAGTGTTGAGAGACCGACCATGAGAGAGGTTGTCCAGATGATCTCTCAGGCTAAACAGCCTAATACTTTCTAAATGCAGTGATGTTATATATATAAGAGACTAaatatatatttttctgttttatgtgtttcatagagttttgtttttAGAATTTGTAATGATGGTTTGGTGGTGATATGAGTTTATATTGAAATTGAGGAGGAAAAAAAGGGTTAGCATTATATCTTCCTA


Protein sequences

Name Description Sequence
At.32731 translated coding region predicted by ESTScan from UniGene At.32731

MADKIFTFFLILSSISPLLCSSLISPLNLSLIRQANVLISLKQSFDSYDPSLDSWNIPNFNSLCSWTGVSCDNLNQSITRLDLSNLNISGTISPEISRLSPSLVFLDISSNSFSGELPKEIYELSGLEVLNISSNVFEGELETRGFSQMTQLVTLDAYDNSFNGSLPLSLTTLTRLEHLDLGGNYFDGEIPRSYGSFLSLKFLSLSGNDLRGRIPNELANITTLVQLYLGYYNDYRGGIPADFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNFLTGEIPEEEAGNAQFSSLTQINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHNQISGQIPVQISQIRILNYLNVSWNSFNQSLPNELGYMKSLTSADFSHNNFSGSVPTSGQFSYFNNTSFLGNPFLCGFSSNPCNGSQNQSQSQLLNQNNARSRGEISAKFKLFFGLGLLGFFLVFVVLAVVKNRRMRKNNPNLWKLIGFQKLGFRSEHILECVKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQAKQPNTF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF516
1-990 BAM3 (BIG APICAL MERISTEM 3); ATP BINDING / PROTEIN SERINE/THREONINE KINASE

MADKIFTFFLILSSISPLLCSSLISPLNLSLIRQANVLISLKQSFDSYDPSLDSWNIPNFNSLCSWTGVSCDNLNQSITRLDLSNLNISGTISPEISRLSPSLVFLDISSNSFSGELPKEIYELSGLEVLNISSNVFEGELETRGFSQMTQLVTLDAYDNSFNGSLPLSLTTLTRLEHLDLGGNYFDGEIPRSYGSFLSLKFLSLSGNDLRGRIPNELANITTLVQLYLGYYNDYRGGIPADFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNFLTGEIPEEEAGNAQFSSLTQINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHNQISGQIPVQISQIRILNYLNVSWNSFNQSLPNELGYMKSLTSADFSHNNFSGSVPTSGQFSYFNNTSFLGNPFLCGFSSNPCNGSQNQSQSQLLNQNNARSRGEISAKFKLFFGLGLLGFFLVFVVLAVVKNRRMRKNNPNLWKLIGFQKLGFRSEHILECVKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQAKQPN

HMMPanther: PTHR24420
1-990 FAMILY NOT NAMED,FAMILY NOT NAMED

MADKIFTFFLILSSISPLLCSSLISPLNLSLIRQANVLISLKQSFDSYDPSLDSWNIPNFNSLCSWTGVSCDNLNQSITRLDLSNLNISGTISPEISRLSPSLVFLDISSNSFSGELPKEIYELSGLEVLNISSNVFEGELETRGFSQMTQLVTLDAYDNSFNGSLPLSLTTLTRLEHLDLGGNYFDGEIPRSYGSFLSLKFLSLSGNDLRGRIPNELANITTLVQLYLGYYNDYRGGIPADFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNFLTGEIPEEEAGNAQFSSLTQINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHNQISGQIPVQISQIRILNYLNVSWNSFNQSLPNELGYMKSLTSADFSHNNFSGSVPTSGQFSYFNNTSFLGNPFLCGFSSNPCNGSQNQSQSQLLNQNNARSRGEISAKFKLFFGLGLLGFFLVFVVLAVVKNRRMRKNNPNLWKLIGFQKLGFRSEHILECVKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQAKQPN

Seg: seg
10-32 seg

LILSSISPLLCSSLISPLNLSLI

HMMPfam: PF08263
IPR013210
34-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QANVLISLKQSFDSYDPSLDSWNIPNFNSLCSWTGVSCD

Gene3D: G3DSA:3.80.10.10
34-230 no description

QANVLISLKQSFDSYDPSLDSWNIPNFNSLCSWTGVSCDNLNQSITRLDLSNLNISGTISPEISRLSPSLVFLDISSNSFSGELPKEIYELSGLEVLNISSNVFEGELETRGFSQMTQLVTLDAYDNSFNGSLPLSLTTLTRLEHLDLGGNYFDGEIPRSYGSFLSLKFLSLSGNDLRGRIPNELANITTLVQLYLG

superfamily: SSF52047
80-404 RNI-like,LRR

RLDLSNLNISGTISPEISRLSPSLVFLDISSNSFSGELPKEIYELSGLEVLNISSNVFEGELETRGFSQMTQLVTLDAYDNSFNGSLPLSLTTLTRLEHLDLGGNYFDGEIPRSYGSFLSLKFLSLSGNDLRGRIPNELANITTLVQLYLGYYNDYRGGIPADFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLF

ProfileScan: PS51450
IPR001611
102-124 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVFLDISSNSFSGELPKEIYEL

HMMSmart: SM00369
IPR003591
124-148 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSGLEVLNISSNVFEGELETRGFSQ

Seg: seg
165-176 seg

SLPLSLTTLTRL

HMMSmart: SM00369
IPR003591
173-199 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLEHLDLGGNYFDGEIPRSYGSFLS

ProfileScan: PS51450
IPR001611
175-197 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLEHLDLGGNYFDGEIPRSYGSF

Seg: seg
196-206 seg

SFLSLKFLSLS

HMMPfam: PF00560
IPR001611
199-220 LRR_1
Leucine-rich repeat

SLKFLSLSGNDLRGRIPNELAN

ProfileScan: PS51450
IPR001611
199-221 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKFLSLSGNDLRGRIPNELANI

Gene3D: G3DSA:3.80.10.10
232-363 no description

YNDYRGGIPADFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNFTGKIPSKL

HMMSmart: SM00369
IPR003591
246-269 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLVHLDLANCSLKGSIPAELGN

ProfileScan: PS51450
IPR001611
248-271 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVHLDLANCSLKGSIPAELGNLK

HMMPfam: PF12799
248-284 LRR_4,Leucine Rich repeats (2 copies)

NLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELT

HMMSmart: SM00369
IPR003591
270-293 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLEVLFLQTNELTGSVPRELGN

ProfileScan: PS51450
IPR001611
272-295 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLFLQTNELTGSVPRELGNMT

HMMSmart: SM00369
IPR003591
294-318 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTSLKTLDLSNNFLEGEIPLELSGL

HMMPfam: PF00560
IPR001611
296-318 LRR_1
Leucine-rich repeat

SLKTLDLSNNFLEGEIPLELSGL

ProfileScan: PS51450
IPR001611
296-319 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLDLSNNFLEGEIPLELSGLQ

superfamily: SSF52047
317-599 RNI-like,LRR

GLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNFLTGEIPEEEAGNAQFSSLTQINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHNQISGQIPVQISQIRILNYLNVSWNSFNQSLPNELGYMKSLTSADFSHNNFS

Seg: seg
318-331 seg

LQKLQLFNLFFNRL

ProfileScan: PS51450
IPR001611
320-342 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQLFNLFFNRLHGEIPEFVSEL

HMMSmart: SM00369
IPR003591
342-366 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPDLQILKLWHNNFTGKIPSKLGSN

ProfileScan: PS51450
IPR001611
344-366 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLQILKLWHNNFTGKIPSKLGSN

ProfileScan: PS51450
IPR001611
368-389 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLIEIDLSTNKLTGLIPESLCF

Gene3D: G3DSA:3.80.10.10
368-629 no description

NLIEIDLSTNKLTGLIPESLCFGRRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNFLTGEIPEEEAGNAQFSSLTQINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHNQISGQIPVQISQIRILNYLNVSWNSFNQSLPNELGYMKSLTSADFSHNNFSGSVPTSGQFSYFNNTSFLGNPFLCGFSSNP

Seg: seg
395-404 seg

ILILFNNFLF

HMMSmart: SM00369
IPR003591
438-463 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLSLLELQNNFLTGEIPEEEAGNA

ProfileScan: PS51450
IPR001611
440-462 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSLLELQNNFLTGEIPEEEAGN

HMMSmart: SM00369
IPR003591
465-488 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FSSLTQINLSNNRLSGPIPGSIRN

HMMPfam: PF00560
IPR001611
467-489 LRR_1
Leucine-rich repeat

SLTQINLSNNRLSGPIPGSIRNL

ProfileScan: PS51450
IPR001611
467-489 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTQINLSNNRLSGPIPGSIRNL

HMMSmart: SM00369
IPR003591
489-513 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLQILLLGANRLSGQIPGEIGSL

ProfileScan: PS51450
IPR001611
491-513 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQILLLGANRLSGQIPGEIGSL

HMMPfam: PF13855
491-550 LRR_8,Leucine rich repeat

SLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHNQI

ProfileScan: PS51450
IPR001611
539-561 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLSHNQISGQIPVQISQI

Seg: seg
626-646 seg

SSNPCNGSQNQSQSQLLNQNN

Gene3D: G3DSA:2.60.120.200
IPR013320
642-728 no description
Concanavalin A-like lectin/glucanase, subgroup

LNQNNARSRGEISAKFKLFFGLGLLGFFLVFVVLAVVKNRRMRKNNPNLWKLIGFQKLGFRSEHILECVKENHVIGKGGRGIVYKGV

Seg: seg
655-679 seg

AKFKLFFGLGLLGFFLVFVVLAVVK

superfamily: SSF56112
IPR011009
680-983 Protein kinase-like (PK-like)
Protein kinase-like domain

NRRMRKNNPNLWKLIGFQKLGFRSEHILECVKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMI

ProfileScan: PS50011
IPR000719
710-992 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

VKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQAKQPNTF

HMMSmart: SM00220
IPR002290
710-992 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQAKQPNTF

HMMSmart: SM00219
IPR020635
710-983 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VKENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMI

HMMPfam: PF00069
IPR017442
712-981 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENHVIGKGGRGIVYKGVMPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAFCSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQ

Gene3D: G3DSA:3.30.200.20
729-774 no description

MPNGEEVAVKKLLTITKGSSHDNGLAAEIQTLGRIRHRNIVRLLAF

Gene3D: G3DSA:1.10.510.10
775-983 no description

CSNKDVNLLVYEYMPNGSLGEVLHGKAGVFLKWETRLQIALEAAKGLCYLHHDCSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMI

PatternScan: PS00108
IPR008271
832-844 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox