PRGDB00066313 (At.32757)

From PRG Wiki
Jump to: navigation, search
At.32757
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79508006 (NM_120800)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ERL2 (ERECTA-LIKE 2); kinase (ERL2) mRNA, complete cds

DNA Sequence

TCTCCCAACAATGGCAGAACGACTTTGTACCCTTCTTTTGCTCTTTGTTTGAATTTCGTTTCTTGCTACAAAGCTTCAAAGGATCTGACTTTTCCCTAAACAGAAAAAGAGGTCTTTAACCAAAAAAGGTTGTTACTTGTTTTCTGGGTTTCGTGGTGTTACTCTTGAGgaagaagaagaagaagatgagaaggatagagaCCATGAAAGGCTTGTTTTTTTGTCTGGGGATGGTGGTTTTCATGCTACTTGGTTCTGTTTCTCCAATGAACAACGAAGGAAAAGCGTTGATGGCGATAAAGGCTTCATTCAGCAACGTGGCGAATATGCTTCTTGATTGGGACGATGTTCATAACCACGACTTTTGTTCTTGGAGAGGTGTCTTCTGTGATAACGTTAGCCTCAATGTTGTCTCTCTTAATCTGTCAAACCTGAATCTTGGTGGAGAGATATCATCTGCCCTTGGAGATTTGATGAATCTGCAATCAATAGACTTGCAAGGAAATAAATTGGGTGGTCAAATTCCAGATGAGATTGGAAACTGTGTTTCTCTTGCTTATGTGGATTTCTCCACCAATTTGTTGTTTGGAGACATACCGTTTTCAATCTCTAAACTCAAACAGCTGGAGTTTCTGAACCTAAAGAATAATCAGCTCACTGGTCCAATACCAGCAACCTTAACTCAGATTCCAAACCTTAAGACCCTTGACCTCGCAAGAAACCAGCTTACTGGTGAGATACCAAGGTTACTCTACTGGAATGAAGTTTTACAGTATCTCGGTTTACGTGGGAATATGTTAACTGGGACATTGTCTCCTGATATGTGTCAGCTGACGGGTCTGTGGTACTTTGATGTGAGAGGCAACAACCTTACTGGAACTATCCCAGAGAGCATTGGCAATTGCACAAGCTTTGAGATCTTGGATGTATCTTATAATCAGATTACCGGAGTTATACCCTACAATATTGGTTTCCTCCAAGTAGCTACTCTGTCACTTCAAGGAAACAAGTTGACTGGCAGAATTCCGGAAGTGATTGGTCTGATGCAGGCTCTTGCTGTATTGGATTTGAGTGACAATGAATTAACTGGGCCTATTCCACCAATACTTGGGAATCTGTCATTCACTGGAAAACTGTATCTCCATGGCAACAAGCTCACTGGACAAATCCCACCCGAGCTAGGCAATATGTCACGACTCAGCTATTTGCAACTAAATGATAATGAACTAGTGGGAAAGATCCCACCTGAGCTTGGGAAGCTGGAACAATTGTTCGAACTGAATCTTGCGAACAACAATCTTGTAGGGCTGATTCCATCTAACATTAGTTCCTGTGCTGCCTTGAATCAATTCAATGTTCATGGGAACTTCTTGAGTGGAGCTGTACCACTTGAATTCCGGAATCTTGGAAGCTTGACTTATCTAAATCTTTCCTCAAACAGTTTCAAGGGCAAAATACCTGCTGAGCTTGGCCATATCATCAATCTTGATACATTGGATCTGTCTGGCAACAATTTCTCAGGCTCAATTCCATTAACACTTGGTGATCTTGAGCATCTTCTCATCTTAAACTTGAGCAGAAATCATCTGAATGGCACATTGCCTGCAGAATTCGGGAACCTCCGAAGCATTCAGATCATCGATGTGTCATTTAATTTTCTTGCCGGTGTTATTCCAACTGAACTTGGCCAGTTGCAGAACATAAACTCTCTGATACTGAACAACAACAAGATTCATGGGAAAATCCCTGATCAGCTAACTAACTGCTTCAGTCTTGCCAATCTGAACATCTCCTTCAATAATCTTTCTGGAATAATCCCACCTATGAAGAACTTTACACGTTTTTCCCCGGCCAGCTTCTTTGGAAATCCATTTCTCTGCGGGAACTGGGTTGGATCAATCTGTGGCCCATCTTTACCTAAGTCACAAGTATTCACCAGAGTTGCCGTGATTTGTATGGTTCTCGGTTTCATCACTCTCATATGCATGATATTCATTGCGGTTTACAAGTCAAAGCAGCAGAAACCAGTCTTGAAAGGCTCTTCAAAACAACCTGAAGGGTCAACGAAGCTGGTGATTCTTCACATGGACATGGCTATTCACACGTTTGATGATATCATGAGAGTTACAGAAAACCTCGATGAGAAATACATCATTGGATACGGTGCTTCTAGCACAGTTTACAAGTGCACCTCCAAAACTTCCCGACCTATTGCCATTAAGCGAATCTACAATCAGTATCCCAGCAACTTCCGCGAGTTTGAAACAGAGCTCGAGACCATTGGGAGCATCAGACACAGAAACATAGTAAGCTTGCACGGATACGCCTTATCTCCCTTTGGCAACCTCCTCTTCTACGACTACATGGAAAATGGCTCTCTTTGGGATCTTCTCCATGGGCCTGGGAAGAAGGTGAAGCTTGACTGGGAAACAAGGCTGAAGATAGCTGTTGGAGCTGCGCAAGGACTTGCATATCTTCACCATGACTGCACACCTAGGATAATCCATCGAGACATCAAGTCATCAAACATACTCCTTGATGGGAATTTCGAAGCGCGTTTGTCAGATTTTGGGATTGCCAAGAGCATACCAGCCACCAAAACTTATGCTTCAACCTATGTTCTTGGAACCATTGGATATATTGACCCAGAGTATGCTCGAACTTCGCGTCTGAACGAGAAGTCTGATATCTACAGTTTCGGTATTGTCCTTCTTGAGCTTCTAACCGGCAAGAAGGCTGTGGATAACGAGGCCAACTTGCATCAAATGATTCTATCAAAGGCGGATGATAACACAGTAATGGAAGCTGTTGATGCAGAGGTCTCAGTGACTTGCATGGACTCAGGACACATCAAGAAAACATTTCAGCTAGCTCTCTTGTGCACCAAGCGAAATCCTTTGGAGAGACCCACCATGCAGGAGGTCTCTAGGGTTCTGCTCTCACTTGTCCCGTCTCCACCTCCAAAGAAGTTACCGTCGCCTGCAAAAGTACAGGAAGGGGAAGAACGGCGTGAGAGCCACTCTTCAGATACAACAACCCCACAGTGGTTTGTTCAGTTCCGTGAAGATATCTCCAAAAGTAGCTTATAAGATAATAACTTTTAGGGTTCCCTTTTCTGTTGTGTTCTTGTATGTCAAGAAAGATCGGAGGGGCAGGTTTTTAAGTGATTTAGGGCTAGTATGAGGGGTATTTTGGGAAGGGAGATAAAATTGAAGGCATTAAAGATAAGAACATGGGATAGGTGAAAGAGTAGGTGAAGTTAATTGTTTTTCCAATGGACATCTTCACGAGTTCGTTAAAAGTCT


Protein sequences

Name Description Sequence
At.32757 translated coding region predicted by ESTScan from UniGene At.32757

MVVFMLLGSVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPPMKNFTRFSPASFFGNPFLCGNWVGSICGPSLPKSQVFTRVAVICMVLGFITLICMIFIAVYKSKQQKPVLKGSSKQPEGSTKLVILHMDMAIHTFDDIMRVTENLDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLVPSPPPKKLPSPAKVQEGEERRESHSSDTTTPQWFVQFREDISKSSL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF825
1-947 SUBFAMILY NOT NAMED

MVVFMLLGSVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPPMKNFTRFSPASFFGNPFLCGNWVGSICGPSLPKSQVFTRVAVICMVLGFITLICMIFIAVYKSKQQKPVLKGSSKQPEGSTKLVILHMDMAIHTFDDIMRVTENLDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLVPSPPPKKLPSPAKVQEGEERRESHSSDTTTPQWFVQFREDI

HMMPanther: PTHR24420
1-947 FAMILY NOT NAMED,FAMILY NOT NAMED

MVVFMLLGSVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPPMKNFTRFSPASFFGNPFLCGNWVGSICGPSLPKSQVFTRVAVICMVLGFITLICMIFIAVYKSKQQKPVLKGSSKQPEGSTKLVILHMDMAIHTFDDIMRVTENLDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLVPSPPPKKLPSPAKVQEGEERRESHSSDTTTPQWFVQFREDI

superfamily: SSF52058
10-307 L domain-like,LRR

VSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGN

HMMPfam: PF08263
IPR013210
13-54 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

MNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCD

Gene3D: G3DSA:3.80.10.10
15-172 no description

NEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPR

Seg: seg
55-70 seg

NVSLNVVSLNLSNLNL

HMMSmart: SM00369
IPR003591
81-105 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LMNLQSIDLQGNKLGGQIPDEIGNC

ProfileScan: PS51450
IPR001611
83-105 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSIDLQGNKLGGQIPDEIGNC

HMMPfam: PF00560
IPR001611
83-105 LRR_1
Leucine-rich repeat

NLQSIDLQGNKLGGQIPDEIGNC

HMMSmart: SM00369
IPR003591
129-152 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKQLEFLNLKNNQLTGPIPATLTQ

HMMPfam: PF12799
130-167 LRR_4,Leucine Rich repeats (2 copies)

KQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLT

ProfileScan: PS51450
IPR001611
131-151 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEFLNLKNNQLTGPIPATLT

HMMSmart: SM00369
IPR003591
153-177 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IPNLKTLDLARNQLTGEIPRLLYWN

ProfileScan: PS51450
IPR001611
155-177 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKTLDLARNQLTGEIPRLLYWN

ProfileScan: PS51450
IPR001611
179-201 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLQYLGLRGNMLTGTLSPDMCQL

Gene3D: G3DSA:3.80.10.10
180-296 no description

LQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNL

HMMSmart: SM00369
IPR003591
201-225 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTGLWYFDVRGNNLTGTIPESIGNC

HMMPfam: PF00560
IPR001611
204-225 LRR_1
Leucine-rich repeat

LWYFDVRGNNLTGTIPESIGNC

ProfileScan: PS51450
IPR001611
227-246 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SFEILDVSYNQITGVIPYNI

ProfileScan: PS51450
IPR001611
250-272 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QVATLSLQGNKLTGRIPEVIGLM

HMMSmart: SM00369
IPR003591
272-296 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MQALAVLDLSDNELTGPIPPILGNL

ProfileScan: PS51450
IPR001611
274-296 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALAVLDLSDNELTGPIPPILGNL

HMMPfam: PF00560
IPR001611
275-296 LRR_1
Leucine-rich repeat

LAVLDLSDNELTGPIPPILGNL

Gene3D: G3DSA:3.80.10.10
297-551 no description

SFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPPMKNFTRFSPASFFGNPFLCG

superfamily: SSF52058
308-551 L domain-like,LRR

KLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPPMKNFTRFSPASFFGNPFLCG

ProfileScan: PS51450
IPR001611
322-344 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLSYLQLNDNELVGKIPPELGKL

HMMSmart: SM00369
IPR003591
344-368 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LEQLFELNLANNNLVGLIPSNISSC

ProfileScan: PS51450
IPR001611
346-367 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLFELNLANNNLVGLIPSNISS

HMMSmart: SM00369
IPR003591
392-416 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGSLTYLNLSSNSFKGKIPAELGHI

ProfileScan: PS51450
IPR001611
394-416 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLNLSSNSFKGKIPAELGHI

HMMPfam: PF12799
394-430 LRR_4,Leucine Rich repeats (2 copies)

SLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFS

ProfileScan: PS51450
IPR001611
418-441 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLDTLDLSGNNFSGSIPLTLGDLE

HMMSmart: SM00369
IPR003591
440-463 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LEHLLILNLSRNHLNGTLPAEFGN

ProfileScan: PS51450
IPR001611
442-464 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLLILNLSRNHLNGTLPAEFGNL

HMMPfam: PF00560
IPR001611
442-464 LRR_1
Leucine-rich repeat

HLLILNLSRNHLNGTLPAEFGNL

Seg: seg
485-499 seg

LGQLQNINSLILNNN

HMMSmart: SM00369
IPR003591
488-512 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQNINSLILNNNKIHGKIPDQLTNC

ProfileScan: PS51450
IPR001611
490-512 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NINSLILNNNKIHGKIPDQLTNC

ProfileScan: PS51450
IPR001611
514-535 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLANLNISFNNLSGIIPPMKNF

superfamily: SSF56112
IPR011009
608-925 Protein kinase-like (PK-like)
Protein kinase-like domain

PEGSTKLVILHMDMAIHTFDDIMRVTENLDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLVPSPPPKKLPSPAKVQEGEE

Gene3D: G3DSA:3.30.200.20
628-718 no description

DIMRVTENLDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLW

ProfileScan: PS50011
IPR000719
636-906 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLV

HMMSmart: SM00220
IPR002290
636-903 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLL

HMMSmart: SM00219
IPR020635
636-902 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVL

HMMPfam: PF00069
IPR017442
640-899 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVS

PatternScan: PS00107
IPR017441
642-664 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGYGASSTVYKCTSKTSRPIAIK

Gene3D: G3DSA:1.10.510.10
719-933 no description

DLLHGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVLLSLVPSPPPKKLPSPAKVQEGEERRESHSSD

PatternScan: PS00108
IPR008271
757-769 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL

Seg: seg
898-920 seg

VSRVLLSLVPSPPPKKLPSPAKV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox