PRGDB00066327 (At.33397)

From PRG Wiki
Jump to: navigation, search
At.33397
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 42461880 (BX826411)
Gene Class Unknown
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Full-length cDNA Complete sequence from clone GSLTFB23ZD12 of Flowers and buds of strain col-0 of Arabidopsis thaliana (thale cress)

DNA Sequence

CAAAATCCGAAATCTTTGTTTCAAATCTCAATTCTTGAGAGATTTTCTTATAACAAATACTACAAAAATCTTTTGAGTTTGAAAAAATAATATTTCATCATTAGATTTACCCTGGTTTATAGGGAATATCCgatctttcttcttatctatttggtttattttcttcttagttctttttGTAGATAAGATCAATGAAACTCATTCTCTCTTTTCACCTCTATTCTCGGGACATAATTATCCACGAGTCACAAAAGAGAGTATAATCTTTGTTTACCACACGGGTTTAAAAACCTAATCTGATATCAGTCCCCTACTTCACTTCTTGCAtatttttagatctatttctctcttttttcttctctttctctctttcATGGAGTTTGTTACAGAAACGTTAGGCAAGAGAATCCATGATCCGTACGTGGAGGAAACTAGGTGCTTAATGATTCCCGGACCAATCATTGTCGGTTCCGGGCCGTCGGGACTGGCCACAGCGGCATGTTTAAAGTCGAGAGACATCCCTAGTTTGATTCTAGAACGTTCCACTTGCATAGCGTCACTATGGCAGCACAAAACATATGATCGTCTTCGACTTCATCTCCCTAAAGATTTCTGTGAGCTTCCATTGATGCCTTTTCCTTCAAGCTACCCTACTTACCCTACAAAGCAACAGTTCGTCCAATACCTTGAGTCTTACGCCGAACATTTTGACCTAAAGCCCGTTTTTAACCAGACCGTGGAGGAAGCCAAGTTCGATAGGCGGTGTGGGTTATGGAGGGTGAGGACAACCGGAGGGAAGAAGGATGAGACAATGGAGTATGTATCACGGTGGCTTGTTGTGGCGACCGGGGAGAATGCCGAGGAGGTGATGCCGGAGATTGATGGAATCCCGGATTTTTGGTGGACCTATCCTCCACACAAGCTCCTATAAGAGCGGTGAAATATTTAGTGAGAAGAAGATTTTGGTTGTAGGATGTGGAAACTCCGGGATGGAAGTTTGTTTAGACCTTTGCAACTTCAATGCTCTTCCTTCTCTTGTGGTTCGTGACTCGGTACACGTATTACCTCAAGAAATGCTAGGTATATCGACTTTCGGGATATCCACGAGCCTGCTCAAGTGGTTTCCAGTGCACGTGGTGGACCGGTTCTTGTTACGTATGTCTCGGTTGGTTCTTGGTGACACGGATCGGTTAGGGTTAGTTCGACCAAAACTTGGCCCTCTTGAACGCAAGATCAAATGCGGAAAGACTCCTGTTTTGGACGTTGGCACTCTTGCCAAAATCCGAAGTGGACACATCAAGGTGTATCCGGAGTTGAAACGGGTAATGCATTATTCGGCAGAGTTTGTTGATGGGAGAGTAGATAACTTCGACGCCATTATACTCGCCACGGGTTACAAAAGCAACGTACCCATGTGGCTAAAGGGAGTGAACATGTTTTCTGAGAAAGATGGATTTCCGCATAAACCATTTCTAACGGTTGGAAAGGCGAAAGCGGATTGTATGCAGTCGTTTCACAAAGCTTGGATTGCTTGGTGCAGCCATTGATGCCAAGAAGATCGCTGAGGATATTGAGGTTCAACGACATTTCTTACCATTGGCTCGTCCTCAACATTCCTAATTAACCTGAGATTCGGGTTTCGATTTGGCAAGTTTGGATTGGGTTATCTAAGAAGTAGAAAGGTAGTAGTGGATGCATTTATGTAAGGTTCCTAACTCTTTAATTGTGACATATGAGAGTTAGAAAGCAGGGTTAGATCAAAGATTAGGTCAAAGATTTTTTGTATTTTTGGGAAGGAAATATTAGATCATGGTCCACATTTGTATATATTTATTTGGTTTTGT


Protein sequences

Name Description Sequence
At.33397 translated coding region predicted by ESTScan from UniGene At.33397

MEFVTETLGKRIHDPYVEETRCLMIPGPIIVGSGPSGLATAACLKSRDIPSLILERSTCIASLWQHKTYDRLRLHLPKDFCELPLMPFPSSYPTYPTKQQFVQYLESYAEHFDLKPVFNQTVEEAKFDRRCGLWRVRTTGGKKDETMEYVSRWLVVATGENAEEVMPEIDGIPVFGGPILHTSSYKSGEIFSEKKILVVGCGNSGMEVCLDLCNFNALPSLVVRDSVHVLPQEMLGISTFGISTSLLKWFPVHVVDRFLLRMSRLVLGDTDRLGLVRPKLGPLERKIKCGKTPVLDVGTLAKIRSGHIKVYPELKRVMHYSAEFVDGRVDNFDAIILATGYKSNVPMWLKGVNMFSEKDGFPHKPFLTVGKAKADCMQSFTKLGLLGAAIDAKKIAEDIEVQRHFLPLARPQHS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
10-402 MONOOXYGENASE,MONOOXYGENASE

KRIHDPYVEETRCLMIPGPIIVGSGPSGLATAACLKSRDIPSLILERSTCIASLWQHKTYDRLRLHLPKDFCELPLMPFPSSYPTYPTKQQFVQYLESYAEHFDLKPVFNQTVEEAKFDRRCGLWRVRTTGGKKDETMEYVSRWLVVATGENAEEVMPEIDGIPVFGGPILHTSSYKSGEIFSEKKILVVGCGNSGMEVCLDLCNFNALPSLVVRDSVHVLPQEMLGISTFGISTSLLKWFPVHVVDRFLLRMSRLVLGDTDRLGLVRPKLGPLERKIKCGKTPVLDVGTLAKIRSGHIKVYPELKRVMHYSAEFVDGRVDNFDAIILATGYKSNVPMWLKGVNMFSEKDGFPHKPFLTVGKAKADCMQSFTKLGLLGAAIDAKKIAEDIEVQ

HMMPanther: PTHR23023
10-402 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

KRIHDPYVEETRCLMIPGPIIVGSGPSGLATAACLKSRDIPSLILERSTCIASLWQHKTYDRLRLHLPKDFCELPLMPFPSSYPTYPTKQQFVQYLESYAEHFDLKPVFNQTVEEAKFDRRCGLWRVRTTGGKKDETMEYVSRWLVVATGENAEEVMPEIDGIPVFGGPILHTSSYKSGEIFSEKKILVVGCGNSGMEVCLDLCNFNALPSLVVRDSVHVLPQEMLGISTFGISTSLLKWFPVHVVDRFLLRMSRLVLGDTDRLGLVRPKLGPLERKIKCGKTPVLDVGTLAKIRSGHIKVYPELKRVMHYSAEFVDGRVDNFDAIILATGYKSNVPMWLKGVNMFSEKDGFPHKPFLTVGKAKADCMQSFTKLGLLGAAIDAKKIAEDIEVQ

Seg: seg
25-37 seg

IPGPIIVGSGPSG

FPrintScan: PR00469
IPR000103
27-49 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPIIVGSGPSGLATAACLKSRDI

FPrintScan: PR00368
IPR013027
28-47 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PIIVGSGPSGLATAACLKSR

superfamily: SSF51905
29-311 FAD/NAD(P)-binding domain

IIVGSGPSGLATAACLKSRDIPSLILERSTCIASLWQHKTYDRLRLHLPKDFCELPLMPFPSSYPTYPTKQQFVQYLESYAEHFDLKPVFNQTVEEAKFDRRCGLWRVRTTGGKKDETMEYVSRWLVVATGENAEEVMPEIDGIPVFGGPILHTSSYKSGEIFSEKKILVVGCGNSGMEVCLDLCNFNALPSLVVRDSVHVLPQEMLGISTFGISTSLLKWFPVHVVDRFLLRMSRLVLGDTDRLGLVRPKLGPLERKIKCGKTPVLDVGTLAKIRSGHIKVY

Gene3D: G3DSA:3.50.50.60
29-204 no description

IIVGSGPSGLATAACLKSRDIPSLILERSTCIASLWQHKTYDRLRLHLPKDFCELPLMPFPSSYPTYPTKQQFVQYLESYAEHFDLKPVFNQTVEEAKFDRRCGLWRVRTTGGKKDETMEYVSRWLVVATGENAEEVMPEIDGIPVFGGPILHTSSYKSGEIFSEKKILVVGCGNS

HMMPfam: PF00743
IPR020946
30-352 FMO-like
Flavin-containing monooxygenase-like

IVGSGPSGLATAACLKSRDIPSLILERSTCIASLWQHKTYDRLRLHLPKDFCELPLMPFPSSYPTYPTKQQFVQYLESYAEHFDLKPVFNQTVEEAKFDRRCGLWRVRTTGGKKDETMEYVSRWLVVATGENAEEVMPEIDGIPVFGGPILHTSSYKSGEIFSEKKILVVGCGNSGMEVCLDLCNFNALPSLVVRDSVHVLPQEMLGISTFGISTSLLKWFPVHVVDRFLLRMSRLVLGDTDRLGLVRPKLGPLERKIKCGKTPVLDVGTLAKIRSGHIKVYPELKRVMHYSAEFVDGRVDNFDAIILATGYKSNVPMWLKGV

FPrintScan: PR00368
IPR013027
151-169 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

SRWLVVATGENAEEVMPEI

FPrintScan: PR00469
IPR000103
191-215 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FSEKKILVVGCGNSGMEVCLDLCNF

FPrintScan: PR00368
IPR013027
195-213 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

KILVVGCGNSGMEVCLDLC

Gene3D: G3DSA:3.40.50.720
IPR016040
307-350 no description
NAD(P)-binding domain

HIKVYPELKRVMHYSAEFVDGRVDNFDAIILATGYKSNVPMWLK

superfamily: SSF51905
323-399 FAD/NAD(P)-binding domain

EFVDGRVDNFDAIILATGYKSNVPMWLKGVNMFSEKDGFPHKPFLTVGKAKADCMQSFTKLGLLGAAIDAKKIAEDI

Seg: seg
388-400 seg

AAIDAKKIAEDIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox