PRGDB00066338 (At.33934)

From PRG Wiki
Jump to: navigation, search
At.33934
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145339985 (NM_116735)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana lectin protein kinase, putative (AT4G04960) mRNA, complete cds

DNA Sequence

ACGCGTACtgtcttcttcgtcttgttcttcttcatctaccatgaaagctcttctctttcttcttACCCTTTTCCTCATCCTCCCAAACCCAATCTCAGCCATTGATTTCATCTTCAACGGCTTCAATGACTCATCATCTAATGTCTCCCTCTTCGGGATCGCAACAATCGAATCAAAAATCCTAACTTTAACAAACCAAACATCGTTTGCAACTGGTCGTGCTCTATACAACAGAACCATCCGTACAAAAGATCCAATCACATCCTCTGTTTTACCTTTCTCTACTTCTTTCATCTTCACCATGGCTCCTTACAAGAACACACTTCCTGGTCACGGAATCGTCTTCCTCTTTGCACCATCCACTGGAATCAACGGTTCTAGCTCTGCTCAACACTTAGGTCTCTTCAATTTGACTAACAATGGTAACCCTAGTAATCACATCTTTGGAGTTGAGTTTGATGTCTTTGCTAATCAAGAATTTAGTGACATCGATGCTAATCATGTCGGAATTGATGTTAATTCACTTCATTCAGTATATTCTAACACTTCTGGTTATTGGTCTGATGATGGAGTGGTGTTTAAGCCATTGAAGCTTAACGATGGAAGAAACTATCAAGTTTGGATTGATTATAGAGATTTTGTAGTTAATGTTACTATGCAAGTCGCTGGTAAGATTCGACCTAAGATTCCTTTGCTTAGTACGTCTTTGAATCTCTCTGATGTTGTGGAAGATGAGATGTTTGTTGGATTCACTGCTGCTACAGGGAGATTGGTTCAGAGTCATAAGATCTTAGCTTGGAGTTTTAGTAATTCGAATTTCTCGTTGAGTAATAGTTTGATCACTACTGGTTTACCTTCGTTTGTTTTACCTAAGGACTCGATTGTTAAAGCGAAATggtttgtttttgtgttggtgttgatctgtttcttggttgttgctttggttggtttggtgttgtttgCTGTGGTGAGAAAGAGATTAGAGAGGGCAAGGAAGAGAGCGTTGATGGAGGATTGGGAGATGGAGTATTGGCCTCATCGGATTCCGTATGAGGAGATTGAATCCGGCACTAAGGGGTTTGATGAGAAGAATGTGATTGGGATTGGCGGGAATGGGAAAGTTTATAAAGGTTTGTTACAAGGAGGGGTTGTGGAAGTTGCGGTTAAGCGGATTTCGCAGGAGAGTAGCGACGGGATGAGAGAGTTTGTGGCTGAGATATCGAGTCTTGGGCGGTTAAAGCACCGGAATTTAGTTTCTTTAAGAGGATGGTGCAAGAAGGAGGTTGGTAGTTTCATGTTGGTTTATGATTACATGGAGAATGGAAGTTTAGATCGATGGATATTCGAAAACGATGAGAAGATTACTACCCTTAGTTGCGAAGAGAGAATTCGTATTTTGAAAGGTGTAGCTTCAGGAATATTGTATTTGCATGAAGGATGGGAGTCTAAGGTTTTACATAGAGATATTAAAGCTAGTAATGTTTTACTTGACCGAGATATGATACCGAGGCTTAGTGATTTTGGGTTAGCTCGGGTTCATGGACACGAGCAACCGGTTAGGACCACGAGGGTGGTTGGTACAGCTGGCTATTTGGCTCCTGAAGTGGTTAAGACGGGGCGTGCATCGACACAGACCGATGTTTTTGCTTACGGGATATTGGTTCTTGAAGTAATGTGTGGGAGAAGACCTATTGAAGAAGGGAAGAAACCGTTGATGGATTGGGTTTGGGGATTAATGGAAAGAGGTGAGATTCTAAATGGGCTTGATCCACAGATGATGATGACACAAGGCGTAACAGAAGTCATTGATGAAGCTGAAAGAGTTTTGCAGCTTGGATTGCTTTGTGCACATCCTGATCCGGCCAAAAGACCGTCGATGAGACAAGTGGTTCAAGTGTTTGAAGGTGATAAGGCTGAGATCTTTGAAGCAGAAAGTAGTGAAGATGTCGAGTCATGGATGTTGATGAAGATGGGATCTCGTGGAAGCTCGCGAGAGTTTTGGTATGGAAGCTCATCACATCCGACGATAGAGCAGATTAGACTTCAGTCTTTGTCTGTGTCTCTTTCGTCTTGGAACAGCTCAATTTTAGAAGGGAGGTGATGATGATGAAGAAATGGCTTGAGGAACCTAAAGAATGTAGTTATTTTTGTGGCTTTACTTTGTTACTTGTTTTGTACATATACGTATTTGTAAACGCATTTCATTATACATGTAtttttttattttaatttttttGTTGTGAATTGAAACTAGTTTTCAATTTATTATATTTTGATGTGTATATAAACAAGTTTTGCATCCGAAGTTAAATGATAAATAATTTAAGAGAA


Protein sequences

Name Description Sequence
At.33934 translated coding region predicted by ESTScan from UniGene At.33934

XRVLSSSSCSSSSTMKALLFLLTLFLILPNPISAIDFIFNGFNDSSSNVSLFGIATIESKILTLTNQTSFATGRALYNRTIRTKDPITSSVLPFSTSFIFTMAPYKNTLPGHGIVFLFAPSTGINGSSSAQHLGLFNLTNNGNPSNHIFGVEFDVFANQEFSDIDANHVGIDVNSLHSVYSNTSGYWSDDGVVFKPLKLNDGRNYQVWIDYRDFVVNVTMQVAGKIRPKIPLLSTSLNLSDVVEDEMFVGFTAATGRLVQSHKILAWSFSNSNFSLSNSLITTGLPSFVLPKDSIVKAKWFVFVLVLICFLVVALVGLVLFAVVRKRLERARKRALMEDWEMEYWPHRIPYEEIESGTKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVFEGDKAEIFEAESSEDVESWMLMKMGSRGSSREFWYGSSSHPTIEQIRLQSLSVSLSSWNSSILEGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF615
2-699 LECTIN PROTEIN KINASE, PUTATIVE

RVLSSSSCSSSSTMKALLFLLTLFLILPNPISAIDFIFNGFNDSSSNVSLFGIATIESKILTLTNQTSFATGRALYNRTIRTKDPITSSVLPFSTSFIFTMAPYKNTLPGHGIVFLFAPSTGINGSSSAQHLGLFNLTNNGNPSNHIFGVEFDVFANQEFSDIDANHVGIDVNSLHSVYSNTSGYWSDDGVVFKPLKLNDGRNYQVWIDYRDFVVNVTMQVAGKIRPKIPLLSTSLNLSDVVEDEMFVGFTAATGRLVQSHKILAWSFSNSNFSLSNSLITTGLPSFVLPKDSIVKAKWFVFVLVLICFLVVALVGLVLFAVVRKRLERARKRALMEDWEMEYWPHRIPYEEIESGTKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVFEGDKAEIFEAESSEDVESWMLMKMGSRGSSREFWYGSSSHPTIEQIRLQSLSVSLSSWNSSILEG

HMMPanther: PTHR24420
2-699 FAMILY NOT NAMED,FAMILY NOT NAMED

RVLSSSSCSSSSTMKALLFLLTLFLILPNPISAIDFIFNGFNDSSSNVSLFGIATIESKILTLTNQTSFATGRALYNRTIRTKDPITSSVLPFSTSFIFTMAPYKNTLPGHGIVFLFAPSTGINGSSSAQHLGLFNLTNNGNPSNHIFGVEFDVFANQEFSDIDANHVGIDVNSLHSVYSNTSGYWSDDGVVFKPLKLNDGRNYQVWIDYRDFVVNVTMQVAGKIRPKIPLLSTSLNLSDVVEDEMFVGFTAATGRLVQSHKILAWSFSNSNFSLSNSLITTGLPSFVLPKDSIVKAKWFVFVLVLICFLVVALVGLVLFAVVRKRLERARKRALMEDWEMEYWPHRIPYEEIESGTKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVFEGDKAEIFEAESSEDVESWMLMKMGSRGSSREFWYGSSSHPTIEQIRLQSLSVSLSSWNSSILEG

Seg: seg
5-13 seg

SSSSCSSSS

Seg: seg
18-28 seg

LLFLLTLFLIL

superfamily: SSF49899
IPR008985
34-273 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

AIDFIFNGFNDSSSNVSLFGIATIESKILTLTNQTSFATGRALYNRTIRTKDPITSSVLPFSTSFIFTMAPYKNTLPGHGIVFLFAPSTGINGSSSAQHLGLFNLTNNGNPSNHIFGVEFDVFANQEFSDIDANHVGIDVNSLHSVYSNTSGYWSDDGVVFKPLKLNDGRNYQVWIDYRDFVVNVTMQVAGKIRPKIPLLSTSLNLSDVVEDEMFVGFTAATGRLVQSHKILAWSFSNSN

Gene3D: G3DSA:2.60.120.200
IPR013320
34-274 no description
Concanavalin A-like lectin/glucanase, subgroup

AIDFIFNGFNDSSSNVSLFGIATIESKILTLTNQTSFATGRALYNRTIRTKDPITSSVLPFSTSFIFTMAPYKNTLPGHGIVFLFAPSTGINGSSSAQHLGLFNLTNNGNPSNHIFGVEFDVFANQEFSDIDANHVGIDVNSLHSVYSNTSGYWSDDGVVFKPLKLNDGRNYQVWIDYRDFVVNVTMQVAGKIRPKIPLLSTSLNLSDVVEDEMFVGFTAATGRLVQSHKILAWSFSNSNF

HMMPfam: PF00139
IPR001220
34-270 Lectin_legB
Legume lectin, beta chain

AIDFIFNGFNDSSSNVSLFGIATIESKILTLTNQTSFATGRALYNRTIRTKDPITSSVLPFSTSFIFTMAPYKNTLPGHGIVFLFAPSTGINGSSSAQHLGLFNLTNNGNPSNHIFGVEFDVFANQEFSDIDANHVGIDVNSLHSVYSNTSGYWSDDGVVFKPLKLNDGRNYQVWIDYRDFVVNVTMQVAGKIRPKIPLLSTSLNLSDVVEDEMFVGFTAATGRLVQSHKILAWSFS

Seg: seg
268-280 seg

SFSNSNFSLSNSL

Seg: seg
301-338 seg

FVFVLVLICFLVVALVGLVLFAVVRKRLERARKRALME

superfamily: SSF56112
IPR011009
331-634 Protein kinase-like (PK-like)
Protein kinase-like domain

ARKRALMEDWEMEYWPHRIPYEEIESGTKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVF

Gene3D: G3DSA:3.30.200.20
344-424 no description

YWPHRIPYEEIESGTKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGW

ProfileScan: PS50011
IPR000719
361-642 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVFEGDKAEIF

HMMSmart: SM00219
IPR020635
361-634 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVF

HMMSmart: SM00220
IPR002290
361-634 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVF

HMMPfam: PF00069
IPR017442
363-632 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRNLVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQ

PatternScan: PS00107
IPR017441
367-390 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGIGGNGKVYKGLLQGGVVEVAVK

Gene3D: G3DSA:1.10.510.10
425-632 no description

CKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYLHEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRTTRVVGTAGYLAPEVVKTGRASTQTDVFAYGILVLEVMCGRRPIEEGKKPLMDWVWGLMERGEILNGLDPQMMMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQ

PatternScan: PS00108
IPR008271
485-497 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDIKASNVLL

Seg: seg
682-697 seg

LQSLSVSLSSWNSSIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox