PRGDB00066339 (At.33963)

From PRG Wiki
Jump to: navigation, search
At.33963
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145339811 (NM_116193)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ATNEK4 (NIMA-RELATED KINASE 4); ATP binding

DNA Sequence

AAGGAAAATCTCATACTACTAATTTGAAATTTAAGAAAAAAAGGAAGGCGAATCGTAGACGGGAAATTGTTCTTTTGCCGCTCTCGGACGAATCGTCTGTGTATTAGTAGTTTGATTCTCTTCACCACGGTGTCGGTACGATTGAAGCTCCTCCCTCCAAGAGCCTTCGTACAGAGACGTTTCTGCTGAAATTTCAAGCAAGTGTGTTTGTCAGATGGAGCGGTATGAAGTCTTGGAGCAGATCGGGAAAGGGTCCTTTGGCTCTGCTCTTCTTGTTAGACACAAACAAGAACGCAAGAAATACGTTTTGAAAAAGATTCGTCTCGCCCGCCAGTCTGATAGGGCTCGACGATCAGCTCATCAGGAGATGGAGCTCATTTCTACTGTCCGCAATCCATTTGTTGTCGAGTACAAAGATTCATGGGTTGAAAAGGGTTGCTATGTGTGCATTGTTATTGGATATTGCCAAGGCGGGGACATGACAGATACCATCAAAAGAGCATGTGGTGTTCATTTTCCTGAGGAGAAATTATGCCAATGGCTTGTCCAACTATTAATGGCCCTCGATTATCTTCACTCCAACCATATTCTTCACCGCGATGTCAAGTGTTCTAACATATTCTTGACAAAAGAGCAAGACATACGGCTTGGTGACTTTGGACTCGCTAAGATTCTAACTTCTGATGACCTTACATCCTCTGTTGTTGGAACTCCAAGCTACATGTGTCCTGAGCTTCTTGCTGACATACCTTACGGATCAAAGTCAGACATTTGGTCGTTGGGATGCTGCATGTATGAAATGGCTGCTCATAAACCTCCTTTCAAAGCTTCCGATGTGCAGACACTGATCACCAAAATACACAAGTTGATAATGGATCCTATTCCCGCCATGTATTCCGGCTCATTCCGAGGCCTTATTAAAAGCATGTTGAGGAAAAATCCTGAACTCAGGCCAAGCGCTAACGAGCTGCTTAACCATCCTCATCTTCAGCCTTACATCAGTATGGTTTATATGAAGCTAGAGAGCCCCAGAAGAAGCACTTTTCCACTCCAATTTTCTGAGAGGGACGCTACATTGAAGGAAAGAAGGCGTTCATCATTCAGCAACGACAGGAGATTGAATCCGAGTGTCTCTGATACAGAAGCAGGTTCTGTTTCTTCTTCAGGAAAAGCATCTCCTACACCAATGTTTAATGGAAGAAAAGTGTCAGAAGTAACTGTGGGAGTCGTCAGAGAAGAAATTGTTCCTCAACGGCAAGAGGAAGCCAAGAAGCAATCAGGTGCAGCCAGAACACCAAGAGTGGCTGGGACCTCAGCTAAAGCAAGCACGCAGCGTACTGTTTTTAAACATGAACTAATGAAGGTATCGAATCCTACAGAGAGGAGAAGGAGAGTATCTCTGCCGTTGGTCGTGGAAAATCCTTACACTTATGAATCAGATATTACAGCTCTTTGTTCCCTAAATTCACCGGATGTTTCTGTAAACACTCCAAGATTCGACAAGATCGCTGAATTCCCTGAAGATATCTTCCAAAACCAAAACAGAGAGACAGCGTCAAGAAGAGAAGTAGCTAGGCACTCTTTTTCTTCTCCTCCTTGTCCGCCTCATGGTGAGGACAATTCCAACGGTTCGATCACAAAGGACAAGTGTACTGTACAGAAAAGGTCAGTTTCGGAGGTAAAACAGAGAAGGTTCGACACGTCATCGTATCAGCAGCGTGCGGAGGCTCTGGAGGGACTGCTGGAGTTCAGTGCAAAGCTTTTGCAGCAGGAACGGTACGATGAGCTCGGGGTTCTGCTTAAACCCTTTGGAGCCGAGAGGGTGTCTTCGAGGGAGACGGCCATCTGGTTGACCAAGAGCTTCAAAGAAGCTTCCGTGTAGATGAAGCAACCATAACAAACGCTCTATCTCTTCTTCTCTTGGCTTGCTTTTGTCCTGTGTGGTTTGTATATAAATAAAAACGACGACGCATTCGGTTCTCATTGCTTAAATGTTTATCCGAAAGCTTGCAGTTTGGGCCTTGTTGGGCCAATTCGTTAGTGGATTTGTTTGGACATTTTGAATT


Protein sequences

Name Description Sequence
At.33963 translated coding region predicted by ESTScan from UniGene At.33963

MERYEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHLQPYISMVYMKLESPRRSTFPLQFSERDATLKERRRSSFSNDRRLNPSVSDTEAGSVSSSGKASPTPMFNGRKVSEVTVGVVREEIVPQRQEEAKKQSGAARTPRVAGTSAKASTQRTVFKHELMKVSNPTERRRRVSLPLVVENPYTYESDITALCSLNSPDVSVNTPRFDKIAEFPEDIFQNQNRETASRREVARHSFSSPPCPPHGEDNSNGSITKDKCTVQKRSVSEVKQRRFDTSSYQQRAEALEGLLEFSAKLLQQERYDELGVLLKPFGAERVSSRETAIWLTKSFKEASV

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
1-114 G3DSA:3.30.200.20

MERYEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLL

HMMPanther: PTHR24362:SF158
1-470 PTHR24362:SF158

MERYEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHLQPYISMVYMKLESPRRSTFPLQFSERDATLKERRRSSFSNDRRLNPSVSDTEAGSVSSSGKASPTPMFNGRKVSEVTVGVVREEIVPQRQEEAKKQSGAARTPRVAGTSAKASTQRTVFKHELMKVSNPTERRRRVSLPLVVENPYTYESDITALCSLNSPDVSVNTPRFDKIAEFPEDIFQNQNRETASRREVARHSFSSPPCPPHGEDNS

HMMPanther: PTHR24362
1-470 PTHR24362,SERINE/THREONINE-PROTEIN KINASE NEK

MERYEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHLQPYISMVYMKLESPRRSTFPLQFSERDATLKERRRSSFSNDRRLNPSVSDTEAGSVSSSGKASPTPMFNGRKVSEVTVGVVREEIVPQRQEEAKKQSGAARTPRVAGTSAKASTQRTVFKHELMKVSNPTERRRRVSLPLVVENPYTYESDITALCSLNSPDVSVNTPRFDKIAEFPEDIFQNQNRETASRREVARHSFSSPPCPPHGEDNS

superfamily: SSF56112
IPR011009
2-289 Kinase_like
Protein kinase-like domain

ERYEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHLQPYISMVYMKLESPRRSTFPLQFSERDATLK

HMMPfam: PF00069
IPR017442
4-257 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPH

ProfileScan: PS50011
IPR000719
4-258 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHL

HMMSmart: SM00220
IPR002290
4-258 S_TKc
Serine/threonine-protein kinase domain

YEVLEQIGKGSFGSALLVRHKQERKKYVLKKIRLARQSDRARRSAHQEMELISTVRNPFVVEYKDSWVEKGCYVCIVIGYCQGGDMTDTIKRACGVHFPEEKLCQWLVQLLMALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHL

PatternScan: PS00107
IPR017441
10-33 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGSFGSALLVRHKQERKKYVLK

Gene3D: G3DSA:1.10.510.10
115-259 G3DSA:1.10.510.10

MALDYLHSNHILHRDVKCSNIFLTKEQDIRLGDFGLAKILTSDDLTSSVVGTPSYMCPELLADIPYGSKSDIWSLGCCMYEMAAHKPPFKASDVQTLITKIHKLIMDPIPAMYSGSFRGLIKSMLRKNPELRPSANELLNHPHLQ

PatternScan: PS00108
IPR008271
125-137 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHRDVKCSNIFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox