PRGDB00066348 (At.34227)

From PRG Wiki
Jump to: navigation, search
At.34227
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18412144 (NM_106534)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana curculin-like (mannose-binding) lectin family protein (AT1G78860) mRNA, complete cds

DNA Sequence

ATGGAATTCTCAACCACATTAGCTCTGTTCTTCACTCTCTCCATATTCTTGGTCGGAGCACAAGCCAAAGTTCCCGTCGACGACCAATTTCGAGTGGTCAACGAAGGAGGCTACACCGATTACAGTCCCATCGAATACAACCCCGACGTACGTGGCTTCGTCCCCTTCAGCGACAACTTCCGTCTCTGTTTCTACAACACAACCCAAAACGCATACACTCTCGCTCTTAGAATCGGAAACAGAGCCCAAGAATCCACTCTAAGATGGGTCTGGGAAGCAAACAGAGGCTCACCAGTCAAAGAAAACGCCACGTTGACTTTCGGCGAAGATGGAAACCTTGTACTTGCTGAAGCCGATGGCCGCGTGGTCTGGCAAACGAACACGGCTAACAAAGGCGTCGTGGGGATCAAAATTTTGGAGAATGGCAATATGGTAATATATGATTCAAATGGAAAATTCGTATGGCAAAGCTTTGACTCTCCGACCGACACGCTTCTCGTTGGACAGTCTTTGAAACTCAACGGTCAAAACAAGCTCGTAAGCAGACTTTCTCCATCGGTCAACGCAAACGGACCGTACAGTCTCGTGATGGAAGCCAAGAAGCTAGTCTTGTACTACACGACAAACAAAACTCCAAAACCAATCGGTTACTACGAATACGAATTCTTCACCAAGATAGCTCAGTTACAGTCTATGACGTTCCAAGCTGTGGAGGATGCCGACACCACGTGGGGTCTACACATGGAAGGTGTCGACTCTGGTTCTCAATTCAACGTCTCGACGTTCCTCTCGCGGCCTAAACACAATGCGACGTTGAGTTTTCTTCGGTTAGAGTCAGACGGAAACATCAGAGTTTGGAGTTACAGTACGTTGGCGACTTCCACGGCTTGGGACGTAACGTACACGGCGTTTACTAACGACAACACTGACGGTAACGATGAGTGTAGGATCCCTGAGCATTGTTTGGGGTTTGGTTTGTGTAAGAAAGGTCAGTGTAACGCTTGTCCTAGCGACATAGGGCTTCTTGGTTGGGATGAGACTTGCAAGATTCCGAGTCTCGCTAGTTGCGATCCCAAGACATTTCACTATTTCAAGATCGAAGGAGCTGATAGTTTTATGACGAAGTATAACGGTGGATCAACGACAACGGAGAGTGCGTGTGGGGACAAATGTACGAGAGATTGTAAGTGTTTAGGGTTTTTCTACAATAGGAAGAGTTCGAGGTGTTGGTTGGGTTATGAGCTCAAGACATTGACTAAAACCGGAGATACTTCCCTAGTTGCTTATGTCAAGGCTCCGAATGCTAGCAAGAAGTCAGCTCTTGCCATTTGA


Protein sequences

Name Description Sequence
At.34227 translated coding region predicted by ESTScan from UniGene At.34227

MEFSTTLALFFTLSIFLVGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRLCFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIGYYEYEFFTKIAQLQSMTFQAVEDADTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWSYSTLATSTAWDVTYTAFTNDNTDGNDECRIPEHCLGFGLCKKGQCNACPSDIGLLGWDETCKIPSLASCDPKTFHYFKIEGADSFMTKYNGGSTTTESACGDKCTRDCKCLGFFYNRKSSRCWLGYELKTLTKTGDTSLVAYVKAPNASKKSALAI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11795:SF316
1-415 PTHR11795:SF316,CURCULIN-LIKE (MANNOSE-BINDING) LECTIN FAMILY PROTEIN

MEFSTTLALFFTLSIFLVGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRLCFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIGYYEYEFFTKIAQLQSMTFQAVEDADTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWSYSTLATSTAWDVTYTAFTNDNTDGNDECRIPEHCLGFGLCKKGQCNACPSDIGLLGWDETCKIPSLASCDPKTFHYFKIEGADSFMTKYNGGSTTTESACGDKCTRDCKCLGFFYNRKSSRCWLGYEL

HMMPanther: PTHR11795
1-415 PTHR11795,UNCHARACTERIZED

MEFSTTLALFFTLSIFLVGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRLCFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIGYYEYEFFTKIAQLQSMTFQAVEDADTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWSYSTLATSTAWDVTYTAFTNDNTDGNDECRIPEHCLGFGLCKKGQCNACPSDIGLLGWDETCKIPSLASCDPKTFHYFKIEGADSFMTKYNGGSTTTESACGDKCTRDCKCLGFFYNRKSSRCWLGYEL

HMMPIR: PIRSF002686
IPR024179
1-438 SLG
S-locus glycoprotein, mannose-binding-type

MEFSTTLALFFTLSIFLVGAQAKVPVDDQFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRLCFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIGYYEYEFFTKIAQLQSMTFQAVEDADTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWSYSTLATSTAWDVTYTAFTNDNTDGNDECRIPEHCLGFGLCKKGQCNACPSDIGLLGWDETCKIPSLASCDPKTFHYFKIEGADSFMTKYNGGSTTTESACGDKCTRDCKCLGFFYNRKSSRCWLGYELKTLTKTGDTSLVAYVKAPNASKK

ProfileScan: PS50927
IPR001480
29-159 BULB_LECTIN
Bulb-type lectin domain

QFRVVNEGGYTDYSPIEYNPDVRGFVPFSDNFRLCFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFD

HMMSmart: SM00108
IPR001480
46-161 B_lectin
Bulb-type lectin domain

YNPDVRGFVPFSDNFRLCFYNTTQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSP

superfamily: SSF51110
IPR001480
68-299 B_lectin
Bulb-type lectin domain

TQNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTNKTPKPIGYYEYEFFTKIAQLQSMTFQAVEDADTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFLRLESDGNIRVWSYSTLATSTAWDV

Gene3D: G3DSA:2.90.10.10
IPR001480
85-209 Bulb-type_lectin_dom
Bulb-type lectin domain

STLRWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTN

HMMPfam: PF01453
IPR001480
88-184 B_lectin
Bulb-type lectin domain

RWVWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDSNGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLS

ProfileScan: PS50948
IPR003609
356-433 PAN
Apple-like

CDPKTFHYFKIEGADSFMTKYNGGSTTTESACGDKCTRDCKCLGFFYNRKSSRCWLGYELKTLTKTGDTSLVAYVKAP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox