PRGDB00066375 (At.35272)

From PRG Wiki
Jump to: navigation, search
At.35272
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337387 (NM_105742)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT1G70740) mRNA, complete cds

DNA Sequence

ACTTTCGTTTCAAATCTAAATCCTTCCTCGCATAAACTCTTCCCTGAATCAAAAACCCATTCTAATAAAAACAAAGACGATCTCAAACACGCTTCTTCTTCTTCCTCATTCCTCAATCATCCCTAAGACGTCACCTCACTTAAACCCAATCCAACGCCGCCGAACCAAAATCAACTTCTTCGGTTCTTCCCCAATTCAATACTACTTTCTGGGTCGTCGTTAAATCCCTAAATCTCTCTCTGTTGTTACCTTCCCATGGGATGGTCACTAAGAACTCTCATAAGAGCAATCTGGGCATGACAAAGTCCATGAATTTCTTTCAGAACATCATTAAACCTTTCAAACGCAGCTCCAATCGAGGTCTTGAAGATGATATTGAGCGAATTGCTGCTATGGAGCAAAAAGTTTTCCCATTTCAAGTTTTAGTTTCCGCTACCAAAGATTTTCACCCGACCCATAAACTCGGTGAAGGTGGTTTCGGTCCCGTCTTCAAGGGAAGATTACCTGACGGGAGAGACATAGCAGTGAAGAAGCTATCTCAGGTTTCAAGGCAAGGCAAAAACGAGTTTGTGAACGAGGCTAAGTTGTTGGCTAAAGTTCAGCATCGCAATGTTGTTAATCTTTGGGGTTATTGTACACATGGAGATGATAAGCTCTTGGTTTATGAGTATGTCGTTAATGAGAGCCTCGACAAGGTCCTCTTCAAATCCAACAGAAAATCGGAGATAGATTGGAAGCAGAGGTTTGAGATCATAACAGGCATTGCTCGAGGACTGCTCTATCTACATGAAGACGCGCCAAACTGCATCATCCACAGGGATATTAAGGCTGGCAATATTTTGCTGGATGAAAAATGGGTTCCTAAGATTGCAGATTTTGGGATGGCTAGACTCTATCAGGAAGATGTAACACATGTCAACACTCGTGTTGCAGGAACCAATGGTTATATGGCGCCAGAGTACGTAATGCACGGGGTTCTATCGGTAAAGGCAGACGTATTCAGCTTTGGGGTTTTGGTTCTGGAGCTCGTAAGTGGACAGAAGAACTCGAGTTTTAGCATGAGACACCCTGACCAGACTCTTCTTGAATGGGCATTTAAGTTGTACAAGAAAGGCCGGACCATGGAGATACTAGACCAAGATATAGCAGCTTCAGCTGATCCAGATCAAGTCAAACTCTGTGTACAGATCGGACTACTCTGCGTTCAAGGCGATCCGCATCAAAGACCGAGCATGAGACGGGTATCTCTACTTCTCTCTAGAAAACCAGGACATCTAGAAGAACCGGATCATCCTGGTGTCCCGGGATCTAGATACCGTCGGCGAACACAACGTCCTTCAGGAGCAGCATCACTTGGAACATTGTCGACCACTGGTTCCAGCACAGATTCTTTCGGTTCAAACCTGAACACAAACACGGGAACTGGTGTTAGAGGTACCCCCGCATCTTCTAAAGCTTCAACTCGGAGTAATGCCACTAGAAGTGCTGGTCAGAGCTCTAGCTCAGACCCTCACGGGAAACGACATATGAGTTATTGAAGTACATAAAATCTGGTCATAGGTGATTGTAAATAGCGAGCTGCATATATAATATTTGTTTCataatttatttaattttgcttttgaaaagtaaattaatttatttttttGACTGCAGTAGTGATTTAGTTTTGTAGTATGATTTGTTATATTAGCGGGAAAAAATTATGATTCATTTGTTACATTTGTATATTAGAATAATCACTTGTAGTCCC


Protein sequences

Name Description Sequence
At.35272 translated coding region predicted by ESTScan from UniGene At.35272

MVTKNSHKSNLGMTKSMNFFQNIIKPFKRSSNRGLEDDIERIAAMEQKVFPFQVLVSATKDFHPTHKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRTQRPSGAASLGTLSTTGSSTDSFGSNLNTNTGTGVRGTPASSKASTRSNATRSAGQSSSSDPHGKRHMSY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF787
13-404 PTHR24420:SF787

MTKSMNFFQNIIKPFKRSSNRGLEDDIERIAAMEQKVFPFQVLVSATKDFHPTHKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRTQRPSGAASLGTLSTTGSSTDSFGSNLNTNTGTGVRGTPASSKASTRSN

HMMPanther: PTHR24420
13-404 PTHR24420,FAMILY NOT NAMED

MTKSMNFFQNIIKPFKRSSNRGLEDDIERIAAMEQKVFPFQVLVSATKDFHPTHKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRTQRPSGAASLGTLSTTGSSTDSFGSNLNTNTGTGVRGTPASSKASTRSN

superfamily: SSF56112
IPR011009
32-340 Kinase_like
Protein kinase-like domain

NRGLEDDIERIAAMEQKVFPFQVLVSATKDFHPTHKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMRRVSLLLSRKPGHLE

Gene3D: G3DSA:3.30.200.20
47-123 G3DSA:3.30.200.20

QKVFPFQVLVSATKDFHPTHKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWG

ProfileScan: PS50011
IPR000719
62-347 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHPTHKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGV

HMMPfam: PF07714
IPR001245
65-329 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

THKLGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFVNEAKLLAKVQHRNVVNLWGYCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMRRVS

Gene3D: G3DSA:1.10.510.10
124-326 G3DSA:1.10.510.10

YCTHGDDKLLVYEYVVNESLDKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKIADFGMARLYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKNSSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQVKLCVQIGLLCVQGDPHQRPSMR

PatternScan: PS00108
IPR008271
183-195 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKAGNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox