PRGDB00066377 (At.35295)

From PRG Wiki
Jump to: navigation, search
At.35295
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337375 (NM_105720)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT1G70520) mRNA, complete cds

DNA Sequence

CTTTCTTCACAACTTGAAACAGAACACAAAACCCTTGATGAGGGAATAAAAAAAGGAGATCTCTTTCTCAATCAAACAAAACAAAATGAAGAAAGAACCTGTCCATATCCTTCCTCTGTACCTTCCATGTCTCTTGATGTTTCTTCTTTCATCACTCCGTCAAATCACCGGAGACGCAAGGGCTAGAGCCGTTAAAGTCACTTGCTCACCTTTGCTTGAGCACAACGAAACCGCTTATGTCCCAAATTTCGTAGCCACAATGGAGAAAATCAGCACACAAGTACAAACTTCCGGTTTTGGAGTTGCTCTCACCGGTACAGGACCAGACGCTAACTATGGTCTTGCGCAGTGCTATGGTGATCTTCCTTTAAACGATTGTGTACTCTGTTACGCGGAAGCAAGGACGATGCTTCCGCAGTGTTATCCTCAGAACGGAGGTAGAATCTTTCTTGATGGATGTTTTATGAGAGCTGAGAATTATAGTTTCTATAATGAATACAAAGGACCTGAAGATAGCATCGTATGTGGAAACACGACGAGAAAGAATAAGACTTTTGGTGATGCGGTGAGACAAGGGCTGAGAAATGCTGTTACTGAGGCTTCTGGGACTGGAGGGTACGCTCGTGCGTCTGCAAAGGCGGGTGAATCTGAATCTGAATCAGCGTTTGTGTTGGCGAATTGTTGGAGAACTTTGAGTCCTGATTCTTGTAAACAGTGTTTGGAGAATGCCTCTGCTTCTGTGGTTAAAGGATGTTTGCCATGGTCAGAAGGACGTGCGCTTCACACTGGATGTTTCCTTCGGTACTCTGATCAAGATTTCTTGAATAAGATACCAAGAAACGGAAGATCAAGAGGCTCTGTGGTAGTGATTGTGGTGTCAGTACTTAGCTCTGTGGTTGTCTTCATGATTGGAGTAGCAGTAAGTGTTTATATCTGCAAACGTCGGACCATAAAGAGGAAGAGAAGAGGATCAAAAGATGTTGAGAAAATGGCGAAAACACTAAAAGACAGTAGCTTGAATTTCAAATACTCAACACTAGAGAAAGCCACAGGTTCTTTTGACAACGCGAACAAGCTTGGACAAGGCGGATTTGGAACTGTCTATAAGGGGGTTCTTCCAGACGGAAGAGATATCGCTGTGAAGCGGTTATTCTTTAACAACAGACATAGAGCAACCGATTTCTACAATGAAGTCAACATGATCAGCACTGTTGAACATAAGAACCTTGTTAGGCTGCTTGGTTGCAGCTGCTCAGGACCAGAGAGTCTCCTTGTCTATGAATACCTTCAGAACAAGAGCCTTGATCGATTCATCTTTGACGTGAACAGAGGGAAAACATTAGACTGGCAGAGAAGATACACGATCATCGTTGGAACCGCTGAAGGATTGGTGTATCTGCATGAGCAGTCGTCTGTGAAAATTATTCACAGAGACATAAAAGCAAGTAATATTCTGCTAGATTCAAAGCTTCAAGCTAAAATCGCCGATTTTGGTCTGGCGAGATCATTCCAGGACGATAAGAGCCATATTAGCACTGCCATTGCAGGGACCTTAGGTTATATGGCTCCGGAGTACTTAGCACATGGTCAGCTAACAGAGATGGTAGACGTTTACAGCTTTGGAGTTCTTGTACTAGAGATTGTAACTGGAAAACAGAACACCAAAAGCAAAATGTCAGATTACTCAGACAGTTTGATCACAGAGGCATGGAAGCATTTTCAGTCAGGAGAGTTGGAGAAAATATATGATCCAAACCTCGATTGGAAGAGTCAGTATGACAGTCACATCATCAAGAAAGAGATAGCAAGAGTTGTTCAAATAGGGCTATTGTGCACTCAAGAGATCCCTTCGCTAAGACCACCGATGTCTAAGTTATTACATATGCTAAAGAACAAAGAGGAGGTCTTGCCATTGCCGAGTAATCCTCCGTTTATGGATGAAAGAGTCATGGAACTTCGAGATGGTTCTGATGGTGATTCAGCTGGTTGTGCATCTCTTGCCACTGTCTCACAAAGTTCCTTTTATGGTAGATGAGCTTTGAAGAAGTGTATAAGAAGAAGAGAATACAAAATCTTTGATCTTTGAGCAGAAACTAAAATTTTGTGTATAAACCAGTGAGAGAAGCTAGATAGTATAGGTAAGTTATATCTTATGTATCATACTTGATAACaaaaaaaaaGTACTCAATAATTC


Protein sequences

Name Description Sequence
At.35295 translated coding region predicted by ESTScan from UniGene At.35295

MKKEPVHILPLYLPCLLMFLLSSLRQITGDARARAVKVTCSPLLEHNETAYVPNFVATMEKISTQVQTSGFGVALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYPQNGGRIFLDGCFMRAENYSFYNEYKGPEDSIVCGNTTRKNKTFGDAVRQGLRNAVTEASGTGGYARASAKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSDQDFLNKIPRNGRSRGSVVVIVVSVLSSVVVFMIGVAVSVYICKRRTIKRKRRGSKDVEKMAKTLKDSSLNFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGELEKIYDPNLDWKSQYDSHIIKKEIARVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVLPLPSNPPFMDERVMELRDGSDGDSAGCASLATVSQSSFYGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
33-134 GNK2,Gnk2-homologous domain profile.

ARAVKVTCSPLLEHNETAYVPNFVATMEKISTQVQTSGFGVALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYPQNGGRIFLDGCFMRAENYSF

HMMPfam: PF01657
IPR002902
46-134 Stress-antifung
Gnk2-homologous domain

HNETAYVPNFVATMEKISTQVQTSGFGVALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYPQNGGRIFLDGCFMRAENYSF

HMMPanther: PTHR24420:SF433
84-628 PTHR24420:SF433,SUBFAMILY NOT NAMED

YGLAQCYGDLPLNDCVLCYAEARTMLPQCYPQNGGRIFLDGCFMRAENYSFYNEYKGPEDSIVCGNTTRKNKTFGDAVRQGLRNAVTEASGTGGYARASAKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSDQDFLNKIPRNGRSRGSVVVIVVSVLSSVVVFMIGVAVSVYICKRRTIKRKRRGSKDVEKMAKTLKDSSLNFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGELEKIYDPNLDWKSQYDSHIIKKEIARVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVLPLPSNPPFMDERVMELRDGS

HMMPanther: PTHR24420
84-628 PTHR24420,FAMILY NOT NAMED

YGLAQCYGDLPLNDCVLCYAEARTMLPQCYPQNGGRIFLDGCFMRAENYSFYNEYKGPEDSIVCGNTTRKNKTFGDAVRQGLRNAVTEASGTGGYARASAKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSDQDFLNKIPRNGRSRGSVVVIVVSVLSSVVVFMIGVAVSVYICKRRTIKRKRRGSKDVEKMAKTLKDSSLNFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGELEKIYDPNLDWKSQYDSHIIKKEIARVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVLPLPSNPPFMDERVMELRDGS

ProfileScan: PS51473
139-245 GNK2,Gnk2-homologous domain profile.

KGPEDSIVCGNTTRKNKTFGDAVRQGLRNAVTEASGTGGYARASAKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSDQDF

HMMPfam: PF01657
IPR002902
147-245 Stress-antifung
Gnk2-homologous domain

CGNTTRKNKTFGDAVRQGLRNAVTEASGTGGYARASAKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSDQDF

Gene3D: G3DSA:2.60.120.200
IPR013320
248-343 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

KIPRNGRSRGSVVVIVVSVLSSVVVFMIGVAVSVYICKRRTIKRKRRGSKDVEKMAKTLKDSSLNFKYSTLEKATGSFDNANKLGQGGFGTVYKGV

superfamily: SSF56112
IPR011009
311-632 Kinase_like
Protein kinase-like domain

LNFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGELEKIYDPNLDWKSQYDSHIIKKEIARVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVLPLPSNPPFMDERVMELRDGSDGDS

ProfileScan: PS50011
IPR000719
325-608 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDNANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGELEKIYDPNLDWKSQYDSHIIKKEIARVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVL

HMMPfam: PF00069
IPR017442
328-539 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLIT

PatternScan: PS00107
IPR017441
331-353 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGTVYKGVLPDGRDIAVK

Gene3D: G3DSA:3.30.200.20
344-400 G3DSA:3.30.200.20

LPDGRDIAVKRLFFNNRHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEY

Gene3D: G3DSA:1.10.510.10
401-609 G3DSA:1.10.510.10

LQNKSLDRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGELEKIYDPNLDWKSQYDSHIIKKEIARVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVLP

PatternScan: PS00108
IPR008271
446-458 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox