PRGDB00066392 (At.36442)

From PRG Wiki
Jump to: navigation, search
At.36442
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 110737441 (AK228765)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana mRNA for S-like receptor protein kinase, complete cds, clone: RAFL16-09-F03

DNA Sequence

AATTCTTCCCGGAAGGTTCTTCTCTGGGTTAGTGGCTTGACGACACAAGTCAAGCAACCTGTCATACACTGACACAAGTCAATCTTGACTGTTGAATTATTCGGCTGCTTTTGGATAGTGACAGTTAAGCCCATATGGTTGGAGTACGAATCAATCGATTGGGGTCATTAAGGTCTTCAAGACATCACCGAAGCTCTGACTTTTTGTTATGCACTGCAAGTGTTCGAGGAAATGCCTAAACGAGATAATTCATAGTCTGCAGTTCAAGAAAAATATAGGTTGTTCTGGGCCTAACAAGCTAGTAAGGACTGGAACAATGAAAACGTTGCGTATCTGATACGGGATAAACAAAGAGAGTCCTTTGTCAATAGGACAAACTCTCAGCTCCTCTAATGGAGTTTATGAATTGGGTTTCTTCAGTTTTAATAACTCGGAAAATCATTATCTTGGAATCTGGTTCAAGGGAATCATTCCCCGGGTGGTTGTGTGGGTGGCCAATAGAGAAAATCCTGTTACAGATTCCACAGCAAATCTCGCTATCAGCAGCAACGCAAGTCTTCTGTTATATAATGGAAAACATGGCGTTGCATGGTCCAGTGGTGAAACTCTTGCTTCTAACGGGTCTCGTGCAGAGCTTTCAGACACCGGAAATCTTATTGTCATAGACAATTTTTCGGGAAGAACTCTTTGGCAAAGCTTTGACCATCTTGGTGATACTATGCTTCCTTTCTCAGCTCTGATGTATAACCTCGCCACTGGCGAGAAGCAGGTCTTGACTTCTTGGAAAAGTTACACTAATCCAGCGGTTGGTGACTTTGTGCTTCAGATTACAACGCAAGTGCCAACACAAGCTTTAACTATGAGAGGCTCGAAGCCTTATTGGAGAAGCGGTCCATGGGCTAAAACAAGGTTCACGGGGGTACCACTAATGGATGATTCATTTACAAATCCATTAAGCCTTTAGCAAGATGCAAACGGGTCAGGATCCCTTACTTATTTAAACAGAAACTTCAAACTTCCACGTATAGTGATAACATCGAAGGGTTCACTGGAGATTTCTAGGCATAGTGGGACTGATTGGGTATTGAACTTTGTGGCTCCAGCGCACTCATGTGATTATTACGGTGTATGTGGACCTTTTGGGATTTGTGTCAAGTCAGTGTGTAAATGCTTCAAAGGGTTTATACCAAAATATATTGAGGAGTGGAAAAGAGGAAATTGGACTGATGGTTGTGTGAGGCGTACCAAACTACATTGTCAGGAAAACTCAACTAAAAAAGATGCAAACTTCTTCCATCCAGTTGCCAACATAAAGCCTCCAGACTTTTACGAATTTGCAAGTGCTGTGGATGCAGAAGGATGCTACAAAATTTGCCTCCACAACTGTTCTTGCTTGGCCTTTTCTTATATTCATGGAATTGGGTGCTTAATATGGAACCAAGACTTCATGGACACAGTGCAATTTTCTGCAGGAGGAGAGATTCTTTCCATTCGTCTTGCACGTTCTGAATTAGGTGGGAATAAGCGCAAGAAGACCATTACTGCTAGTATTGTCAGCCTTTCTCTTTTTCTGATATTGGGTTCTACTGCGTTTGGTTTCTGGAGATACAGAGTTAAACATAATGCTTCACAAGATGCACCGAAATATGATTTGGAACCACAAGATGTCTCAGGTTCATATTTGTTTGAGATGAACACCATTCAAACTGCCACCAATAATTTCAGTCTCTCAAATAAACTGGGACAAGGTGGATTTGGTTCAGTTTACAAGGGAGAGCTGCAAGATGGGAAAGAAATTGCTGTAAAACGGCTTTCTAGCAGCTCAGGGCAGGGCAAAGAGGAGTTCATGAATGAAATAGTACTCATCTCAAAACTACAACACAAAAACTTAGTTCGGATTTTAGGATGTTGCATTGAAGGAGAAGAGAGGCTGTTGATTTATGAGTTTATGTTGAACAAAAGCCTTGATACTTTTCTCTTCGATTCAAGAAAAAGGCTTGAGATTGACTGGCCAAAGAGATTTGATATCATTCAAGGTATTGCGCGTGGAATTCACTATCTCCATCGTGACTCATGCCTCAAGGTAATTCACCGTGATCTGAAGGTCAGCAATATTCTTCTTGACGAGAAGATGAATCCAAAGATATCAGATTTTGGATTGGCTCGGATGTATCAGGGAACCGAATATCAGGACAATACTCGCAGGGTCGTAGGAACTCTAGGATATATGTCTCCAGAGGATATATTAGAAATCATAAGCGGAGAGAAGATCTCAAGATTCAGCTATGGCAAAGAAGAAAAAACCCTTATTGCATATGCATGGGAATCTTGGTGTGAAACTGGAGGAGTTGATCTTTTGGATAAAGATGTTGCTGATTCATGTCGCCCATTAGAAGTTGAGAGATGTATTCAGATTGGTCTTCTCTGTGTTCAACACCAACCTGCAGACAGACCAAACACACTTGAGTTGATGTCTATGCTCACGACAACATCAGATCTTCCATCACCAAAACAACCCACATTTGTAGTGCACTGGAGAGATGACGAATCATCGTCTAAGGATTTGATCACTGTGAATGAGATGACAAAGTCTGTGATCTTAGGGCGTTGAGAAATGATGTTTGATTGAAACTTTAGTCTGTTTTGTAAACGATTTTTTCTATTTATGAAAGGTATATTCCaaaaaaaaaa


Protein sequences

Name Description Sequence
At.36442 translated coding region predicted by ESTScan from UniGene At.36442

MKTLRIXYGINKESPLSIGQTLSSSNGVYELGFFSFNNSENHYLGIWFKGIIPRVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPFSALMYNLATGEKQVLTSWKSYTNPAVGDFVLQITTQVPTQALTMRGSKPYWRSGPWAKTRFTGVPLMDDSFTNPLSLXQDANGSGSLTYLNRNFKLPRIVITSKGSLEISRHSGTDWVLNFVAPAHSCDYYGVCGPFGICVKSVCKCFKGFIPKYIEEWKRGNWTDGCVRRTKLHCQENSTKKDANFFHPVANIKPPDFYEFASAVDAEGCYKICLHNCSCLAFSYIHGIGCLIWNQDFMDTVQFSAGGEILSIRLARSELGGNKRKKTITASIVSLSLFLILGSTAFGFWRYRVKHNASQDAPKYDLEPQDVSGSYLFEMNTIQTATNNFSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSMLTTTSDLPSPKQPTFVVHWRDDESSSKDLITVNEMTKSVILGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
7-128 BULB_LECTIN
Bulb-type lectin domain

XYGINKESPLSIGQTLSSSNGVYELGFFSFNNSENHYLGIWFKGIIPRVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSF

HMMSmart: SM00108
IPR001480
13-131 Bulb-type mannose-specific lectin
Bulb-type lectin domain

ESPLSIGQTLSSSNGVYELGFFSFNNSENHYLGIWFKGIIPRVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSFDHL

superfamily: SSF51110
IPR001480
38-196 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NSENHYLGIWFKGIIPRVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPFSALMYNLATGEKQVLTSWKSYTNPAVGDFVLQITTQVPTQALTMRGSKPYWRSGPWAK

HMMPanther: PTHR24420:SF714
51-764 S-LOCUS PROTEIN KINASE, PUTATIVE

IIPRVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPFSALMYNLATGEKQVLTSWKSYTNPAVGDFVLQITTQVPTQALTMRGSKPYWRSGPWAKTRFTGVPLMDDSFTNPLSLXQDANGSGSLTYLNRNFKLPRIVITSKGSLEISRHSGTDWVLNFVAPAHSCDYYGVCGPFGICVKSVCKCFKGFIPKYIEEWKRGNWTDGCVRRTKLHCQENSTKKDANFFHPVANIKPPDFYEFASAVDAEGCYKICLHNCSCLAFSYIHGIGCLIWNQDFMDTVQFSAGGEILSIRLARSELGGNKRKKTITASIVSLSLFLILGSTAFGFWRYRVKHNASQDAPKYDLEPQDVSGSYLFEMNTIQTATNNFSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSMLTTTSDLPSPKQPTFVVHWRDDESSSKDLITVNEMTKSVILGR

HMMPanther: PTHR24420
51-764 FAMILY NOT NAMED,FAMILY NOT NAMED

IIPRVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPFSALMYNLATGEKQVLTSWKSYTNPAVGDFVLQITTQVPTQALTMRGSKPYWRSGPWAKTRFTGVPLMDDSFTNPLSLXQDANGSGSLTYLNRNFKLPRIVITSKGSLEISRHSGTDWVLNFVAPAHSCDYYGVCGPFGICVKSVCKCFKGFIPKYIEEWKRGNWTDGCVRRTKLHCQENSTKKDANFFHPVANIKPPDFYEFASAVDAEGCYKICLHNCSCLAFSYIHGIGCLIWNQDFMDTVQFSAGGEILSIRLARSELGGNKRKKTITASIVSLSLFLILGSTAFGFWRYRVKHNASQDAPKYDLEPQDVSGSYLFEMNTIQTATNNFSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSMLTTTSDLPSPKQPTFVVHWRDDESSSKDLITVNEMTKSVILGR

HMMPfam: PF01453
IPR001480
54-162 B_lectin
Bulb-type lectin domain

RVVVWVANRENPVTDSTANLAISSNASLLLYNGKHGVAWSSGETLASNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPFSALMYNLATGEKQVLTSWKSYTNP

Seg: seg
71-85 seg

ANLAISSNASLLLYN

Gene3D: G3DSA:2.90.10.10
IPR001480
164-200 no description
Bulb-type lectin domain

VGDFVLQITTQVPTQALTMRGSKPYWRSGPWAKTRFT

HMMPfam: PF00954
IPR000858
189-292 S_locus_glycop
S-locus glycoprotein

WRSGPWAKTRFTGVPLMDDSFTNPLSLXQDANGSGSLTYLNRNFKLPRIVITSKGSLEISRHSGTDWVLNFVAPAHSCDYYGVCGPFGICVKSVCKCFKGFIPK

ProfileScan: PS50948
IPR003609
314-396 PAN
Apple-like

CQENSTKKDANFFHPVANIKPPDFYEFASAVDAEGCYKICLHNCSCLAFSYIHGIGCLIWNQDFMDTVQFSAGGEILSIRLAR

HMMPfam: PF08276
IPR013227
321-380 PAN_2
PAN-2 domain

KDANFFHPVANIKPPDFYEFASAVDAEGCYKICLHNCSCLAFSYIHGIGCLIWNQDFMDT

HMMSmart: SM00473
IPR003609
321-394 divergent subfamily of APPLE domains
Apple-like

KDANFFHPVANIKPPDFYEFASAVDAEGCYKICLHNCSCLAFSYIHGIGCLIWNQDFMDTVQFSAGGEILSIRL

superfamily: SSF56112
IPR011009
441-745 Protein kinase-like (PK-like)
Protein kinase-like domain

APKYDLEPQDVSGSYLFEMNTIQTATNNFSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSMLTTTSDLPSPKQPTFVVHWRDDES

Gene3D: G3DSA:3.30.200.20
456-531 no description

LFEMNTIQTATNNFSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGC

ProfileScan: PS50011
IPR000719
469-736 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSMLTTTSDLPSPKQPTF

HMMSmart: SM00219
IPR020635
469-722 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSML

HMMSmart: SM00220
IPR002290
469-724 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSMLTT

HMMPfam: PF07714
IPR001245
470-721 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLSNKLGQGGFGSVYKGELQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSYGKEEKTLIAYAWESWCETGGVDLLDKDVADSCRPLEVERCIQIGLLCVQHQPADRPNTLELMSM

PatternScan: PS00107
IPR017441
475-497 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGSVYKGELQDGKEIAVK

Gene3D: G3DSA:1.10.510.10
532-657 no description

CIEGEERLLIYEFMLNKSLDTFLFDSRKRLEIDWPKRFDIIQGIARGIHYLHRDSCLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMSPEDILEIISGEKISRFSY

PatternScan: PS00108
IPR008271
590-602 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKVSNILL

Seg: seg
715-728 seg

TLELMSMLTTTSDL

HMMPfam: PF11883
IPR021820
723-764 DUF3403
S-locus receptor kinase, C-terminal

TTTSDLPSPKQPTFVVHWRDDESSSKDLITVNEMTKSVILGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox