PRGDB00066393 (At.36455)

From PRG Wiki
Jump to: navigation, search
At.36455
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30696572 (NM_104823)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana S-locus lectin protein kinase family protein (AT1G61420) mRNA, complete cds

DNA Sequence

AGCTAATCTAAAAAAGATAGTTTTTGGAGAGAAATAACAAATATGGGGAAGAAGTGGATCGTGTTCTTTGCTTATTTGCTCTTATCTAGCTTCTTTATAAGTTCTAGCTCTGCAGGGATAACGAAAGAAAGTCCTTTGCCAATAGGACAAACTCTCAGCTCCTCTAATGGTTTTTATGAACTGGGGTTCTTCAATTTTAATAACTCCCAGAATCAGTATGTCGGAATCTGGTTCAAGGGTATTATTCCCCGGGTGGTTGTGTGGGTGGCCAATAGAGAAAAGCCTGTTACAGATTCCACGGCAAATCTCGCTATCAGCAACAATGGAAGTCTTCTGTTATTTAATGGCAAACATGGCGTTGCATGGTCCAGTGGAGAAGCTCTTGTTTCTAACGGGTCTCGTGCAGAGCTTTCAGACACCGGAAATCTTATTGTCATAGACAATTTTTCGGGAAGAACTCTATGGCAAAGCTTTGACCATCTTGGTGATACTATGCTTCCTTCCTCAACCCTGAAGTATAACCTCGCCACTGGCGAGAAGCAGGTGTTGAGTTCTTGGAAAAGTTACACTGATCCATCGGTTGGCGACTTTGTGCTTCAGATTACGCCACAAGTGCCAACGCAGGTGCTTGTTACGAAAGGATCAACGCCTTATTATAGAAGCGGTCCATGGGCTAAAACAAGGTTCACGGGGATACCGCTAATGGATGACACATTTACAGGTCCAGTCAGCGTTCAGCAGGATACAAATGGGTCAGGATCTCTCACTTATTTAAACAGAAACGATAGACTTCAACGTACAATGCTAACATCAAAGGGCACACAGGAGTTGTCTTGGCATAATGGGACGGACTGGGTATTGAACTTTGTGGCTCCAGAACACTCATGTGATTACTACGGTGTATGTGGACCTTTTGGGTTATGTGTGAAGTCTGTTCCTCCAAAATGTACGTGTTTCAAAGGGTTTGTTCCTAAACTCATTGAGGAGTGGAAAAGAGGAAACTGGACTGGTGGTTGTGTGAGGCGTACCGAACTATATTGTCAAGGAAACTCTACTGGCAAATATGCAAACGTGTTCCATCCTGTTGCCAGGATAAAGCCTCCAGACTTTTACGAATTTGCAAGTTTTGTGAATGTTGAAGAATGCCAGAAAAGTTGCCTCCACAATTGTTCTTGCTTGGCCTTTGCTTATATCGATGGAATTGGGTGCTTAATGTGGAACCAAGACCTAATGGACGCAGTGCAATTTTCTGAAGGAGGAGAACTTCTCTCCATTCGTCTGGCACGTTCTGAACTAGGTGGAAATAAGCGCAAGAAGGCCATTACTGCTAGTATTGTGAGCCTTTCTCTTGTTGTGATAATTGCGTTTGTTGCGTTTTGTTTCTGGAGATATAGAGTGAAACATAATGCTGATATAACAACGGATGCTTCACAAGTTTCATGGAGGAATGATCTGAAACCACAAGATGTCCCAGGTTTAGATTTCTTTGATATGCATACCATTCAAACTGCCACCAATAATTTCAGTATATCAAACAAACTCGGACAAGGTGGATTTGGCCCTGTTTATAAGGGTAAGCTGCAAGATGGGAAAGAAATTGCTGTAAAACGGCTTTCTAGCAGCTCGGGCCAGGGCAAAGAGGAGTTCATGAATGAAATAGTACTCATCTCAAAACTACAACATAAAAACTTAGTTCGGATTTTGGGATGTTGCATTGAAGGAGAAGAGAAGCTATTGATTTATGAGTTCATGTTGAACAATAGCCTTGATACCTTTCTCTTCGATTCAAGAAAAAGGCTTGAGATTGACTGGCCAAAGAGATTGGATATCATTCAAGGTATTGCGCGTGGAATTCACTATCTCCATCGTGACTCACACCTCAAGGTTATTCACCGAGATCTGAAGGTTAGCAATATTCTTCTTGACGAGAAGATGAATCCAAAGATATCAGATTTTGGATTGGCTCGGATGTATCAGGGAACCGAATATCAGGACAATACTCGCAGGGTTGTAGGAACTCTAGGATATATGGCTCCTGAGTATGCATGGACTGGGATGTTTTCTGAAAAGTCCGACATCTATAGCTTTGGAGTTCTAATGTTAGAAATCATAAGCGGGGAGAAGATCTCAAGATTCAGCTATGGCAAAGAAGAAAAAACCCTTATTGCATATGCGTGGGAATCTTGGTGTGATACTGGAGGAATTGATCTCTTGGACAAAGATGTCGCCGATTCATGTCGCCCACTGGAAGTTGAGAGATGTGTTCAGATCGGTCTGCTCTGTGTTCAACACCAACCTGCAGATAGACCCAACACACTTGAGTTGCTGTCTATGCTCACCACAACATCAGATCTTCCACCACCAGAACAACCGACATTTGTAGTGCACAGGAGAGATGACAAATCATCGTCTGAGGATTTGATCACTGTGAATGAGATGACAAAGTCTGTGATCTTAGGGCGTTAAGAAATGATGTTTGATCTTAGGGCGTTGATAACAAACTTCACCTTTTATTCTTTTTGTAACATATTTTTTGTATACATGAACCTCCATTCTGGTGCAC


Protein sequences

Name Description Sequence
At.36455 translated coding region predicted by ESTScan from UniGene At.36455

MGKKWIVFFAYLLLSSFFISSSSAGITKESPLPIGQTLSSSNGFYELGFFNFNNSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPSSTLKYNLATGEKQVLSSWKSYTDPSVGDFVLQITPQVPTQVLVTKGSTPYYRSGPWAKTRFTGIPLMDDTFTGPVSVQQDTNGSGSLTYLNRNDRLQRTMLTSKGTQELSWHNGTDWVLNFVAPEHSCDYYGVCGPFGLCVKSVPPKCTCFKGFVPKLIEEWKRGNWTGGCVRRTELYCQGNSTGKYANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMDAVQFSEGGELLSIRLARSELGGNKRKKAITASIVSLSLVVIIAFVAFCFWRYRVKHNADITTDASQVSWRNDLKPQDVPGLDFFDMHTIQTATNNFSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSDLPPPEQPTFVVHRRDDKSSSEDLITVNEMTKSVILGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF720
1-807 PTHR24420:SF720

MGKKWIVFFAYLLLSSFFISSSSAGITKESPLPIGQTLSSSNGFYELGFFNFNNSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPSSTLKYNLATGEKQVLSSWKSYTDPSVGDFVLQITPQVPTQVLVTKGSTPYYRSGPWAKTRFTGIPLMDDTFTGPVSVQQDTNGSGSLTYLNRNDRLQRTMLTSKGTQELSWHNGTDWVLNFVAPEHSCDYYGVCGPFGLCVKSVPPKCTCFKGFVPKLIEEWKRGNWTGGCVRRTELYCQGNSTGKYANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMDAVQFSEGGELLSIRLARSELGGNKRKKAITASIVSLSLVVIIAFVAFCFWRYRVKHNADITTDASQVSWRNDLKPQDVPGLDFFDMHTIQTATNNFSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSDLPPPEQPTFVVHRRDDKSSSEDLITVNEMTKSVILGR

HMMPanther: PTHR24420
1-807 PTHR24420,FAMILY NOT NAMED

MGKKWIVFFAYLLLSSFFISSSSAGITKESPLPIGQTLSSSNGFYELGFFNFNNSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPSSTLKYNLATGEKQVLSSWKSYTDPSVGDFVLQITPQVPTQVLVTKGSTPYYRSGPWAKTRFTGIPLMDDTFTGPVSVQQDTNGSGSLTYLNRNDRLQRTMLTSKGTQELSWHNGTDWVLNFVAPEHSCDYYGVCGPFGLCVKSVPPKCTCFKGFVPKLIEEWKRGNWTGGCVRRTELYCQGNSTGKYANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMDAVQFSEGGELLSIRLARSELGGNKRKKAITASIVSLSLVVIIAFVAFCFWRYRVKHNADITTDASQVSWRNDLKPQDVPGLDFFDMHTIQTATNNFSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSDLPPPEQPTFVVHRRDDKSSSEDLITVNEMTKSVILGR

HMMPIR: PIRSF000641
IPR024171
2-807 SRK
S-receptor-like serine/threonine-protein kinase

GKKWIVFFAYLLLSSFFISSSSAGITKESPLPIGQTLSSSNGFYELGFFNFNNSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPSSTLKYNLATGEKQVLSSWKSYTDPSVGDFVLQITPQVPTQVLVTKGSTPYYRSGPWAKTRFTGIPLMDDTFTGPVSVQQDTNGSGSLTYLNRNDRLQRTMLTSKGTQELSWHNGTDWVLNFVAPEHSCDYYGVCGPFGLCVKSVPPKCTCFKGFVPKLIEEWKRGNWTGGCVRRTELYCQGNSTGKYANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMDAVQFSEGGELLSIRLARSELGGNKRKKAITASIVSLSLVVIIAFVAFCFWRYRVKHNADITTDASQVSWRNDLKPQDVPGLDFFDMHTIQTATNNFSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSDLPPPEQPTFVVHRRDDKSSSEDLITVNEMTKSVILGR

ProfileScan: PS50927
IPR001480
23-144 BULB_LECTIN
Bulb-type lectin domain

SAGITKESPLPIGQTLSSSNGFYELGFFNFNNSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSF

HMMSmart: SM00108
IPR001480
29-147 B_lectin
Bulb-type lectin domain

ESPLPIGQTLSSSNGFYELGFFNFNNSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHL

superfamily: SSF51110
IPR001480
54-212 B_lectin
Bulb-type lectin domain

NSQNQYVGIWFKGIIPRVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPSSTLKYNLATGEKQVLSSWKSYTDPSVGDFVLQITPQVPTQVLVTKGSTPYYRSGPWAK

HMMPfam: PF01453
IPR001480
70-179 B_lectin
Bulb-type lectin domain

RVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGDTMLPSSTLKYNLATGEKQVLSSWKSYTDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
70-149 Bulb-type_lectin_dom
Bulb-type lectin domain

RVVVWVANREKPVTDSTANLAISNNGSLLLFNGKHGVAWSSGEALVSNGSRAELSDTGNLIVIDNFSGRTLWQSFDHLGD

Gene3D: G3DSA:2.90.10.10
IPR001480
181-216 Bulb-type_lectin_dom
Bulb-type lectin domain

GDFVLQITPQVPTQVLVTKGSTPYYRSGPWAKTRFT

HMMPfam: PF00954
IPR000858
205-311 S_locus_glycop
S-locus glycoprotein

YRSGPWAKTRFTGIPLMDDTFTGPVSVQQDTNGSGSLTYLNRNDRLQRTMLTSKGTQELSWHNGTDWVLNFVAPEHSCDYYGVCGPFGLCVKSVPPKCTCFKGFVPK

ProfileScan: PS50948
IPR003609
333-413 PAN
Apple-like

CQGNSTGKYANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMDAVQFSEGGELLSIRL

HMMSmart: SM00473
IPR003609
338-413 PAN_AP
Apple-like

TGKYANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMDAVQFSEGGELLSIRL

HMMPfam: PF08276
IPR013227
342-398 PAN_2
PAN-2 domain

ANVFHPVARIKPPDFYEFASFVNVEECQKSCLHNCSCLAFAYIDGIGCLMWNQDLMD

superfamily: SSF56112
IPR011009
466-788 Kinase_like
Protein kinase-like domain

SWRNDLKPQDVPGLDFFDMHTIQTATNNFSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSDLPPPEQPTFVVHRRDDKS

Gene3D: G3DSA:3.30.200.20
480-556 G3DSA:3.30.200.20

DFFDMHTIQTATNNFSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGC

ProfileScan: PS50011
IPR000719
494-779 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSDLPPPEQPTF

HMMPfam: PF07714
IPR001245
496-762 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ISNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHKNLVRILGCCIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELL

Gene3D: G3DSA:1.10.510.10
557-770 G3DSA:1.10.510.10

CIEGEEKLLIYEFMLNNSLDTFLFDSRKRLEIDWPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEYQDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIAYAWESWCDTGGIDLLDKDVADSCRPLEVERCVQIGLLCVQHQPADRPNTLELLSMLTTTSD

PatternScan: PS00108
IPR008271
615-627 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKVSNILL

HMMPfam: PF11883
IPR021820
766-807 DUF3403
S-locus receptor kinase, C-terminal

TTTSDLPPPEQPTFVVHRRDDKSSSEDLITVNEMTKSVILGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox