PRGDB00066396 (At.36473)

From PRG Wiki
Jump to: navigation, search
At.36473
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238478924 (NM_001160966)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana S-locus lectin protein kinase family protein (AT1G61360) mRNA, complete cds

DNA Sequence

CTTTTTTATCTCTAAAGTTGTTGTCTTTCTTTTATCATCAATTGTGTGTTGTTGACATTGTTTCTCAGCCAAAGTTTGAGACTTTGGATCGAATCACTTATGCCCAGATGATCTCTGCATGATTAATCACAATTTCTTTTTAAAAAATTGTTTAGTCTTGCACTATTTAAGATTTACCAAAGAGACATGTTGAAGCGACTCGAGAAAGTAGGTACATTGAATTGCTCTTAATTGAGAGAACTGAGATTATTCGAGAAATGGAAAGCTTATGTAACATCCAGCTATTACCACGTCAAGTCCTTTGTCGATAGGGGTAACTTTGAGCTCTCCTGGTGGATCATATGAGCTTGGTTTCTTCAGTTCTAACAACTCTGGGAATCAGTATGTTGGAATCTGGTTCAAGAAAGTCACTCCTCGGGTTATTGTTTGGGTGGCTAACAGAGAAAAGCCAGTCTCTAGTACTATGGCGAATCTCACAATCAGCAGCAATGGAAGTCTTATCTTGCTTGATAGCAAAAAAGATCTGGTGTGGTCATCTGGAGGAGATCCCACATCTAACAAGTGTCGTGCTGAGCTTTTAGACACCGGAAATCTTGTCGTCGTAGATAATGTTACTGGAAATTATTTGTGGCAAAGTTTTGAGCATCTTGGTGATACAATGCTACCTCTTACATCTCTCATGTACGATATTCCTAACAACAAGAAACGTGTGCTGACTTCTTGGAAGAGTGAGACCGATCCATCGCCTGGGGAGTTTGTAGCTGAGATTACACCACAAGTACCCTCGCAAGGCCTTATAAGGAAAGGCTCGTCACCTTATTGGAGAAGCGGTCCATGGGCGGGAACAAGGTTCACTGGGATACCAGAAATGGATGCATCGTATGTGAATCCATTGGGAATGGTCCAAGATGAAGTCAACGGCACAGGAGTTTTCGCTTTTTGTGTTCTGAGAAATTTCAATTTGTCATACATCAAGCTAACGCCAGAAGGATCATTGAGGATTACACGGAATAATGGAACCGACTGGATCAAGCACTTTGAGGGTCCGCTAACCTCGTGTGATCTATATGGTAGATGTGGACCTTTTGGCTTGTGTGTGAGATCCGGTACTCCAATGTGCCAATGCTTAAAAGGGTTCGAACCAAAATCAGATGAGGAGTGGAGAAGTGGGAATTGGAGTCGTGGATGTGTGAGACGCACAAACTTATCTTGTCAAGGAAACTCTTCTGTAGAAACGCAGGGCAAGGACAGAGACGTATTCTATCATGTATCCAACATAAAGCCTCCAGATTCATACGAATTAGCAAGCTTTAGCAATGAAGAACAATGCCACCAAGGCTGTCTCAGGAACTGTTCTTGCACAGCCTTTTCCTATGTCAGTGGAATAGGATGTTTGGTGTGGAACCAGGAGCTGTTGGACACAGTGAAATTTATTGGCGGAGGAGAGACTCTTTCCCTTCGTCTTGCACATTCTGAATTGACTGGAAGAAAGCGAATCAAGATTATCACTGTTGCCACTCTCAGCCTTTCTGTTTGCTTGATTTTGGTGCTTGTTGCATGTGGGTGCTGGAGATACAGAGTAAAACAAAATGGTTCAAGTCTTGTATCCAAAGACAATGTAGAAGGCGCTTGGAAGAGTGATTTACAATCACAAGATGTCTCAGGTTTAAATTTCTTTGAGATTCATGACCTACAAACCGCCACGAATAATTTCAGCGTGTTAAATAAACTCGGTCAGGGTGGATTTGGTACGGTTTATAAGGGGAAGCTTCAGGACGGAAAGGAAATAGCTGTAAAACGTCTTACTAGCAGCTCTGTACAGGGCACAGAGGAGTTCATGAACGAGATAAAACTCATCTCGAAATTACAACACAGAAACTTGCTTCGGCTTTTGGGATGCTGCATCGATGGAGAAGAGAAGCTATTGGTCTATGAATATATGGTGAACAAAAGCCTTGATATCTTTATATTTGATTTGAAGAAAAAGCTTGAGATTGATTGGGCTACGAGATTCAATATCATTCAAGGAATCGCTCGTGGACTTCTCTATCTCCATCGTGACTCATTCCTCAGAGTTGTACACCGCGATCTGAAGGTCAGCAATATTCTCTTGGATGAGAAAATGAACCCAAAAATATCGGATTTTGGATTGGCTCGGCTGTTTCATGGAAATCAACATCAAGACAGCACTGGTAGTGTTGTAGGCACTCTAGGATACATGTCTCCCGAGTATGCTTGGACTGGTACGTTCTCTGAAAAATCCGACATTTACAGCTTCGGAGTTCTGATGCTCGAAATCATCACTGGCAAGGAGATTTCAAGTTTCAGCTATGGCAAAGATAACAAAAACCTTCTTTCATATGCATGGGACTCGTGGAGCGAAAACGGGGGAGTGAATCTACTGGACCAAGATCTTGATGATTCTGATTCAGTTAATTCAGTTGAAGCAGGAAGATGTGTTCATATTGGTCTGCTCTGTGTTCAGCATCAAGCTATTGATAGACCAAACATCAAACAAGTTATGTCAATGCTGACTTCAACAACGGATCTTCCTAAGCCAACACAACCAATGTTTGTATTGGAGACAAGTGATGAGGATTCTTCTCTGTCTCACTCTCAACGCTCCAATGATCTCTCCTCTGTTGATGAAAACAAATCTTCTGAAGAGCTAAATGCTTCCTCATGAATGTTCCAATCGGATTCGTTCACGTGGACTTGCGTTGTTTTGTACAAATTGTCAGTTGTGGAATAAATCAGTGATGTAAATTGGCTTCATAATCTGTAAATTTACATTTACCCTTCTCTTATAAACCTTTTTAATATTC


Protein sequences

Name Description Sequence
At.36473 translated coding region predicted by ESTScan from UniGene At.36473

MXHPAITTSSPLSIGVTLSSPGGSYELGFFSSNNSGNQYVGIWFKKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKSETDPSPGEFVAEITPQVPSQGLIRKGSSPYWRSGPWAGTRFTGIPEMDASYVNPLGMVQDEVNGTGVFAFCVLRNFNLSYIKLTPEGSLRITRNNGTDWIKHFEGPLTSCDLYGRCGPFGLCVRSGTPMCQCLKGFEPKSDEEWRSGNWSRGCVRRTNLSCQGNSSVETQGKDRDVFYHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGGGETLSLRLAHSELTGRKRIKIITVATLSLSVCLILVLVACGCWRYRVKQNGSSLVSKDNVEGAWKSDLQSQDVSGLNFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLTSTTDLPKPTQPMFVLETSDEDSSLSHSQRSNDLSSVDENKSSEELNASS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
3-124 BULB_LECTIN
Bulb-type lectin domain

HPAITTSSPLSIGVTLSSPGGSYELGFFSSNNSGNQYVGIWFKKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSF

HMMPanther: PTHR24420:SF709
5-795 S-LOCUS LECTIN PROTEIN KINASE FAMILY PROTEIN

AITTSSPLSIGVTLSSPGGSYELGFFSSNNSGNQYVGIWFKKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKSETDPSPGEFVAEITPQVPSQGLIRKGSSPYWRSGPWAGTRFTGIPEMDASYVNPLGMVQDEVNGTGVFAFCVLRNFNLSYIKLTPEGSLRITRNNGTDWIKHFEGPLTSCDLYGRCGPFGLCVRSGTPMCQCLKGFEPKSDEEWRSGNWSRGCVRRTNLSCQGNSSVETQGKDRDVFYHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGGGETLSLRLAHSELTGRKRIKIITVATLSLSVCLILVLVACGCWRYRVKQNGSSLVSKDNVEGAWKSDLQSQDVSGLNFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLTSTTDLPKPTQPMFVLETSDEDSSLSHSQRSNDLSSVDEN

HMMPanther: PTHR24420
5-795 FAMILY NOT NAMED,FAMILY NOT NAMED

AITTSSPLSIGVTLSSPGGSYELGFFSSNNSGNQYVGIWFKKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKSETDPSPGEFVAEITPQVPSQGLIRKGSSPYWRSGPWAGTRFTGIPEMDASYVNPLGMVQDEVNGTGVFAFCVLRNFNLSYIKLTPEGSLRITRNNGTDWIKHFEGPLTSCDLYGRCGPFGLCVRSGTPMCQCLKGFEPKSDEEWRSGNWSRGCVRRTNLSCQGNSSVETQGKDRDVFYHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGGGETLSLRLAHSELTGRKRIKIITVATLSLSVCLILVLVACGCWRYRVKQNGSSLVSKDNVEGAWKSDLQSQDVSGLNFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLTSTTDLPKPTQPMFVLETSDEDSSLSHSQRSNDLSSVDEN

HMMSmart: SM00108
IPR001480
9-127 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SSPLSIGVTLSSPGGSYELGFFSSNNSGNQYVGIWFKKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSFEHL

superfamily: SSF51110
IPR001480
34-187 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NSGNQYVGIWFKKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKSETDPSPGEFVAEITPQVPSQGLIRKGSSPYWRS

HMMPfam: PF01453
IPR001480
50-159 B_lectin
Bulb-type lectin domain

RVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELLDTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKSETDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
160-197 no description
Bulb-type lectin domain

PGEFVAEITPQVPSQGLIRKGSSPYWRSGPWAGTRFTG

HMMPfam: PF00954
IPR000858
185-294 S_locus_glycop
S-locus glycoprotein

WRSGPWAGTRFTGIPEMDASYVNPLGMVQDEVNGTGVFAFCVLRNFNLSYIKLTPEGSLRITRNNGTDWIKHFEGPLTSCDLYGRCGPFGLCVRSGTPMCQCLKGFEPKS

ProfileScan: PS50948
IPR003609
315-401 PAN
Apple-like

CQGNSSVETQGKDRDVFYHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGGGETLSLRLAH

HMMPfam: PF08276
IPR013227
326-385 PAN_2
PAN-2 domain

KDRDVFYHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDT

HMMSmart: SM00473
IPR003609
326-399 divergent subfamily of APPLE domains
Apple-like

KDRDVFYHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGGGETLSLRL

Seg: seg
418-429 seg

LSLSVCLILVLV

Gene3D: G3DSA:3.30.200.20
465-543 no description

SGLNFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLG

superfamily: SSF56112
IPR011009
468-786 Protein kinase-like (PK-like)
Protein kinase-like domain

NFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLTSTTDLPKPTQPMFVLETSDEDSSLSHSQRS

ProfileScan: PS50011
IPR000719
482-769 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLTSTTDLPKPTQPMF

HMMSmart: SM00220
IPR002290
482-755 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSML

HMMSmart: SM00219
IPR020635
482-755 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSML

HMMPfam: PF07714
IPR001245
484-684 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFMNEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEIS

PatternScan: PS00107
IPR017441
488-510 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGTVYKGKLQDGKEIAVK

Gene3D: G3DSA:1.10.510.10
544-756 no description

CCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLT

PatternScan: PS00108
IPR008271
603-615 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKVSNILL

Seg: seg
709-725 seg

VNLLDQDLDDSDSVNSV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox