PRGDB00066458 (At.39767)

From PRG Wiki
Jump to: navigation, search
At.39767
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19699083 (AY090246)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At1g34300

DNA Sequence

agaagagagagagaagaagaagaagaagcttcacaatcgtaacaatggcggtgaagacgccatttctcaaacttctccctcttcttctccttctcctccacttccctttctcattctctACCATACCTCTCGGCTCCGTTATTTACGCCTCCGGTTCCAACCAGAACTGGCCATCTCCCAATTCCACTTTCTCCGTCTCCTTTGTTCCATCTCCTTCCCCTAACTCCTTCCTCGCCGCCGTCTCTTTCGCTGGAAGCGTTCCGATATGGTCAGCAGGAACCGTTGACTCACGAGGATCTCTTCGTCTTCACACCTCCGGCTCTCTCCGTCTCACCAACGGCTCCGGAACCACCGTCTGGGACTCTAAAACCGATCGTCTCGGTGTTACTTCCGGTTCGATTGAAGATACCGGTGAATTCATCCTCCTCAATAACCGAAGCGTCCCGGTTTGGTCTTCCTTCGATAATCCGACGGATACAATCGTCCAATCGCAGAATTTCACCGCCGGTAAGATTCTCCGATCTGGTCTTTACTCGTTTCAGTTAGAGAGAAGTGGGAATCTTACTCTTAGGTGGAACACTAGCGCGATTTACTGGAACCATGGACTTAATTCTTCGTTTAGCTCGAATCTATCGTCTCCTAGATTAAGTTTACAGACTAATGGAGTTGTTTCGATCTTCGAATCAAATCTTCTTGGAGGAGCTGAAATCGTTTATAGTGGCGATTACGGTGATAGCAATACGTTTAGGTTCTTGAAGTTAGATGATGATGGGAATTTGAGAATCTACAGTTCTGCTAGTAGAAACAGTGGACCTGTGAATGCTCATTGGTCTGCTGTTGATCAGTGTCTTGTTTATGGATATTGTGGAAACTTTGGGATTTGTAGTTACAATGATACTAATCCGATTTGTTCGTGTCCGTCTCGTAACTTTGATTTTGTTGATGTGAATGATAGAAGAAAGGGATGTAAAAGGAAAGTGGAGCTAAGTGATTGCTCTGGCAATACAACCATGCTTGATTTGGTTCATACGAGGTTGTTTACTTATGAAGACGATCCGAACTCGGAGAGTTTCTTTGCGGGTAGTTCGCCTTGTAGAGCTAATTGTCTTAGTAGTGTTTTGTGTCTTGCTTCTGTTTCCATGTCTGATGGGTCTGGAAATTGTTGGCAGAAACATCCTGGTTCCTTCTTTACTGGGTACCAGTGGCCATCGGTTCCGAGTACTTCTTATGTTAAAGTGTGTGGTCCAGTGGTGGCTAACACACTCGAAAGAGCAACAAAAGGCGACGATAACAACTCGAAAGTGCATTTGTGGATTGTCGCGGTTGCTGTAATAGCTGGGCTTCTTGGTTTGGTTGCAGTAGAGATAGGTCTCTGGTGGTGTTGCTGTAGAAAGAATCCTCGGTTTGGAACTTTGTCGTCTCACTACACTTTGCTTGAGTACGCTTCTGGTGCACCTGTGCAGTTTACTTATAAGGAGCTGCAGCGTTGCACCAAAAGTTTCAAAGAGAAGCTTGGAGCTGGAGGGTTTGGAACTGTGTATAGAGGCGTGCTCACTAATAGAACCGTGGTTGCAGTGAAGCAACTTGAAGGAATAGAGCAAGGAGAGAAGCAGTTTAGAATGGAGGTTGCTACCATTAGCAGCACACACCATCTGAATCTAGTCAGACTGATTGGATTTTGCTCCCAGGGAAGACATAGGCTTCTCGTCTATGAGTTCATGAGAAATGGATCTCTCGATAACTTCCTGTTTACTACTGATTCAGCGAAGTTCTTGACTTGGGAGTATCGGTTTAACATTGCCCTTGGGACGGCTAAGGGAATAACTTACCTCCACGAGGAGTGCCGCGACTGCATTGTACACTGCGACATTAAACCGGAGAACATTCTCGTAGATGACAATTTTGCTGCCAAAGTCTCGGACTTTGGACTTGCCAAACTCTTGAACCCAAAAGACAACAGATACAACATGAGCAGTGTTAGAGGAACAAGAGGCTATTTAGCTCCTGAATGGCTCGCAAATCTTCCCATAACCTCAAAATCGGATGTCTATAGCTATGGAATGGTCCTACTAGAGCTAGTTAGCGGTAAAAGAAACTTTGATGTCTCGGAGAAAACGAACCACAAGAAATTCTCGATCTGGGCATACGAGGAGTTTGAAAAGGGCAACACCAAGGCGATCCTAGACACACGTTTAAGCGAAGATCAAACTGTTGATATGGAACAAGTGATGAGAATGGTTAAGACAAGCTTCTGGTGCATACAAGAGCAGCCATTGCAGAGACCGACAATGGGGAAAGTGGTTCAAATGCTAGAAGGAATCACAGAGATAAAGAACCCACTATGTCCAAAGACCATAAGTGAAGTATCGTTTTCAGGGAACAGTATGAGCACGAGCCATGCATCTATGTTTGTTGCTTCGGGTCCGACTCGTTCATCTTCTTTTTCTGCTACACGATCGTTTCAGACAATGGGGATCACATCGTCTGGACCAGCTTCCACAAGGATCAGTGAAGGCTCTATGCTTGGATCTTAAAAGTGTTGTATTGTGATTACTAATGTCTAGGTTGTTTTGATTTACTTATTTGCATACGTTATAATTGTATAGGAACACTTCAAAGCTATATCTACTTACTATTTATCTGaaaaaaaagaaaaaaaT


Protein sequences

Name Description Sequence
At.39767 translated coding region predicted by ESTScan from UniGene At.39767

MAVKTPFLKLLPLLLLLLHFPFSFSTIPLGSVIYASGSNQNWPSPNSTFSVSFVPSPSPNSFLAAVSFAGSVPIWSAGTVDSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNHGLNSSFSSNLSSPRLSLQTNGVVSIFESNLLGGAEIVYSGDYGDSNTFRFLKLDDDGNLRIYSSASRNSGPVNAHWSAVDQCLVYGYCGNFGICSYNDTNPICSCPSRNFDFVDVNDRRKGCKRKVELSDCSGNTTMLDLVHTRLFTYEDDPNSESFFAGSSPCRANCLSSVLCLASVSMSDGSGNCWQKHPGSFFTGYQWPSVPSTSYVKVCGPVVANTLERATKGDDNNSKVHLWIVAVAVIAGLLGLVAVEIGLWWCCCRKNPRFGTLSSHYTLLEYASGAPVQFTYKELQRCTKSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGITEIKNPLCPKTISEVSFSGNSMSTSHASMFVASGPTRSSSFSATRSFQTMGITSSGPASTRISEGSMLGS

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF000641
IPR024171
7-796 SRK
S-receptor-like serine/threonine-protein kinase

FLKLLPLLLLLLHFPFSFSTIPLGSVIYASGSNQNWPSPNSTFSVSFVPSPSPNSFLAAVSFAGSVPIWSAGTVDSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNHGLNSSFSSNLSSPRLSLQTNGVVSIFESNLLGGAEIVYSGDYGDSNTFRFLKLDDDGNLRIYSSASRNSGPVNAHWSAVDQCLVYGYCGNFGICSYNDTNPICSCPSRNFDFVDVNDRRKGCKRKVELSDCSGNTTMLDLVHTRLFTYEDDPNSESFFAGSSPCRANCLSSVLCLASVSMSDGSGNCWQKHPGSFFTGYQWPSVPSTSYVKVCGPVVANTLERATKGDDNNSKVHLWIVAVAVIAGLLGLVAVEIGLWWCCCRKNPRFGTLSSHYTLLEYASGAPVQFTYKELQRCTKSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGITEIKNPLCPKTISEVSFSGNSMSTSHASMFVASGPTR

HMMPanther: PTHR24420:SF814
14-817 PTHR24420:SF814

LLLLLHFPFSFSTIPLGSVIYASGSNQNWPSPNSTFSVSFVPSPSPNSFLAAVSFAGSVPIWSAGTVDSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNHGLNSSFSSNLSSPRLSLQTNGVVSIFESNLLGGAEIVYSGDYGDSNTFRFLKLDDDGNLRIYSSASRNSGPVNAHWSAVDQCLVYGYCGNFGICSYNDTNPICSCPSRNFDFVDVNDRRKGCKRKVELSDCSGNTTMLDLVHTRLFTYEDDPNSESFFAGSSPCRANCLSSVLCLASVSMSDGSGNCWQKHPGSFFTGYQWPSVPSTSYVKVCGPVVANTLERATKGDDNNSKVHLWIVAVAVIAGLLGLVAVEIGLWWCCCRKNPRFGTLSSHYTLLEYASGAPVQFTYKELQRCTKSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGITEIKNPLCPKTISEVSFSGNSMSTSHASMFVASGPTRSSSFSATRSFQTMGITSSGPA

HMMPanther: PTHR24420
14-817 PTHR24420,FAMILY NOT NAMED

LLLLLHFPFSFSTIPLGSVIYASGSNQNWPSPNSTFSVSFVPSPSPNSFLAAVSFAGSVPIWSAGTVDSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNHGLNSSFSSNLSSPRLSLQTNGVVSIFESNLLGGAEIVYSGDYGDSNTFRFLKLDDDGNLRIYSSASRNSGPVNAHWSAVDQCLVYGYCGNFGICSYNDTNPICSCPSRNFDFVDVNDRRKGCKRKVELSDCSGNTTMLDLVHTRLFTYEDDPNSESFFAGSSPCRANCLSSVLCLASVSMSDGSGNCWQKHPGSFFTGYQWPSVPSTSYVKVCGPVVANTLERATKGDDNNSKVHLWIVAVAVIAGLLGLVAVEIGLWWCCCRKNPRFGTLSSHYTLLEYASGAPVQFTYKELQRCTKSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGITEIKNPLCPKTISEVSFSGNSMSTSHASMFVASGPTRSSSFSATRSFQTMGITSSGPA

HMMSmart: SM00108
IPR001480
33-142 B_lectin
Bulb-type lectin domain

IYASGSNQNWPSPNSTFSVSFVPSPSPNSFLAAVSFAGSVPIWSAGTVDSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNP

superfamily: SSF51110
IPR001480
43-186 B_lectin
Bulb-type lectin domain

PSPNSTFSVSFVPSPSPNSFLAAVSFAGSVPIWSAGTVDSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNH

Gene3D: G3DSA:2.90.10.10
IPR001480
81-189 Bulb-type_lectin_dom
Bulb-type lectin domain

DSRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNHGLN

HMMPfam: PF01453
IPR001480
82-157 B_lectin
Bulb-type lectin domain

SRGSLRLHTSGSLRLTNGSGTTVWDSKTDRLGVTSGSIEDTGEFILLNNRSVPVWSSFDNPTDTIVQSQNFTAGKI

ProfileScan: PS50927
IPR001480
143-260 BULB_LECTIN
Bulb-type lectin domain

TDTIVQSQNFTAGKILRSGLYSFQLERSGNLTLRWNTSAIYWNHGLNSSFSSNLSSPRLSLQTNGVVSIFESNLLGGAEIVYSGDYGDSNTFRFLKLDDDGNLRIYSSASRNSGPVNA

HMMPfam: PF00954
IPR000858
221-292 S_locus_glycop
S-locus glycoprotein

EIVYSGDYGDSNTFRFLKLDDDGNLRIYSSASRNSGPVNAHWSAVDQCLVYGYCGNFGICSYNDTNPICSCP

Gene3D: G3DSA:3.30.200.20
470-559 G3DSA:3.30.200.20

APVQFTYKELQRCTKSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFM

superfamily: SSF56112
IPR011009
472-787 Kinase_like
Protein kinase-like domain

VQFTYKELQRCTKSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGITEIKNPLCPKTISEVSFSGNSMSTSHAS

ProfileScan: PS50011
IPR000719
484-759 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KSFKEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGI

HMMPfam: PF00069
IPR017442
487-754 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KEKLGAGGFGTVYRGVLTNRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQ

PatternScan: PS00107
IPR017441
490-512 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGGFGTVYRGVLTNRTVVAVK

Gene3D: G3DSA:1.10.510.10
561-774 G3DSA:1.10.510.10

NGSLDNFLFTTDSAKFLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILVDDNFAAKVSDFGLAKLLNPKDNRYNMSSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIWAYEEFEKGNTKAILDTRLSEDQTVDMEQVMRMVKTSFWCIQEQPLQRPTMGKVVQMLEGITEIKNPLCPKTISEV

PatternScan: PS00108
IPR008271
604-616 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDIKPENILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox