PRGDB00066491 (At.41222)

From PRG Wiki
Jump to: navigation, search
At.41222
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337991 (NM_111050)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT3G01840) mRNA, complete cds

DNA Sequence

TCTAGAAGTCAGACATGGCTGTTTCAGTTAGTAAGCAGTACATGACAAGTCTTGTAGTGATCTTGCTCTTCATCTCCTTATCATCTCTCTCTCCAACTTCAACTTCACACAGCTGTGACCCTGTCgaagaagaagaagaagCCTCCTCCTTCGGTTACGTTTGCCACTCAAACCTCCAAAAGTGCCACACTTTCGCCATTCTCAGAGCCAAACCTCCCTTCTATTCCCTCTCGGACCTGAGTCGCCATCTTGGTCTCGACGCAGACGACGAGTATGTTCCGAAAGGTCAGTTACTCTTGATCCCAATAGAGTGCAGGTGTAATGGAAGCATCTACGAGGCCAGTCTCATTAAAAATTGCGTTAAAGGAGACACCTTTCGCTCTGTCTCTCAGTCTCTGCAAGGCTTGACCACCTGCCTATCTATCAGAGAGAAGAATCCACATATTTCCGAAGACAAGCTTGGCGACAACATTAAACTGCGTTTGGCGATCAGGTGCTCTTGTCCACAAGAAGGCGTTTCAAACGCTAGTTTTCTCGTTACGTATCCGGTGGGCGTCCGCGACAGCGTTTCAAGCCTGGCGGTTAGGTTTAACACAACAGAGGATGCCATTGTCTCTGCAAACAACAAATCTGGTGTGGTTCCACTCAAGCCTGCTCTCATCCCTCTTGATCACAAACCAGAGAAACAAGGATCCCGGAAAAGAAATCCATCCAAGAAGAAACGGTCAAAGATGAAGCTCATGATCGCTGTGAGCAGCGCGATTGCTGGAGTTTGCGGTCTTGTCACTCTCATGGTGTTTGGTTACTTACACTGGAAGAAAGAGACGCAGATTCAAACGCAAACGCAAAAGTGGATTAGCAACAAAGACCCCGAGACGCGGCAGCTGAGTCTGAGCATCCGAACCACGAGTGACAAGAAAATCTCGTTTGAAGGGTCGCAGGACGGTTCCATCTTGGATTCTCACAACACCGTCGGCACCACAACGCCCCGAAAACCCGTTCTGGAGATTTACGCGTTTGAAGAGTTAGAGAAGGCCACGGAGAATTTCAGTTCAAGCAATCACATCAAAGGTTCGGTTTATTTCGGTTCGCTCAAAGGCAAAGACTTGGCTATAAAGCAAGTCAATGCAGATGAAATGAAAAGATTCGATTTCGGGCTTCTCAATGATCAGTCACACTACTATAACCACAATGTGATTAGGGTTCTTGGAACATGTTTTAGAGAAATCGATCAAGATTCTTATCTGGTTTTCGAGTATGCAAGGAATGGGTCCCTGTGGGATTGGATTCAGAACAAATTGGCCATCAAGAATCAATTCATCGAGTCTTGTTACTGTTTCTTGGCATGGAAACAGAGGATCAAGATATGTCACGATGTCGCCATCGCGTTAAAGTATATGCATCGGATCAACTACGTCCACGGCAACATCAAGAGCAGAAACATCTTCTTGAACGAAGATCTCAGAGGTAAAGTCGGAAACTTTGGGATGTCAAAGTGCGTAACCAATGAATTAGCCACAGAAGAGAACCTTATAGAGAGTTCACTGTCTCCAGCTTCTGACATATTTGCTTACGGGATAATCGTAATGGAGGTTTTGTCTGGACAAACCCCAGATATGTTGCTTGGATTGCAAGAAGTAGAGACAACATCCCTTGGGACACAAGAAACTTTTGTTTCCGAATGGAGTAGATTAAGAAGGCTTCTCGGGGACAAGGAAAAGCTGAGGGAAGTGATGGACAGCACATTGGGAGAGAGCTATTCGGTTGATTCTGCGTTTGAAATCGCAAGTATTGCAAGAGATTGTACTGCAGAAGAAGCCGAGTCAAGGCCGAGCGCGGTTGAGATTGCAGAGAGGGTTTCAAGATTGGTGGATGACGATGAAGATGAAGAAGATGAGGCAGTAATAGATAGAGAGAGTACCTTAATTTCAGAGAGTTCATACAAGCCTTTGGTAAAGAAGAGTAGTATAATAGATTAA


Protein sequences

Name Description Sequence
At.41222 translated coding region predicted by ESTScan from UniGene At.41222

MAVSVSKQYMTSLVVILLFISLSSLSPTSTSHSCDPVEEEEEASSFGYVCHSNLQKCHTFAILRAKPPFYSLSDLSRHLGLDADDEYVPKGQLLLIPIECRCNGSIYEASLIKNCVKGDTFRSVSQSLQGLTTCLSIREKNPHISEDKLGDNIKLRLAIRCSCPQEGVSNASFLVTYPVGVRDSVSSLAVRFNTTEDAIVSANNKSGVVPLKPALIPLDHKPEKQGSRKRNPSKKKRSKMKLMIAVSSAIAGVCGLVTLMVFGYLHWKKETQIQTQTQKWISNKDPETRQLSLSIRTTSDKKISFEGSQDGSILDSHNTVGTTTPRKPVLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRLRRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAERVSRLVDDDEDEEDEAVIDRESTLISESSYKPLVKKSSIID

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
95-654 PTHR24420,FAMILY NOT NAMED

LIPIECRCNGSIYEASLIKNCVKGDTFRSVSQSLQGLTTCLSIREKNPHISEDKLGDNIKLRLAIRCSCPQEGVSNASFLVTYPVGVRDSVSSLAVRFNTTEDAIVSANNKSGVVPLKPALIPLDHKPEKQGSRKRNPSKKKRSKMKLMIAVSSAIAGVCGLVTLMVFGYLHWKKETQIQTQTQKWISNKDPETRQLSLSIRTTSDKKISFEGSQDGSILDSHNTVGTTTPRKPVLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRLRRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAERVSRLVDDDEDEEDEAVIDRESTLISESSYKPLVKKSSIID

HMMPanther: PTHR24420:SF149
95-654 PTHR24420:SF149,PROTEIN KINASE FAMILY PROTEIN

LIPIECRCNGSIYEASLIKNCVKGDTFRSVSQSLQGLTTCLSIREKNPHISEDKLGDNIKLRLAIRCSCPQEGVSNASFLVTYPVGVRDSVSSLAVRFNTTEDAIVSANNKSGVVPLKPALIPLDHKPEKQGSRKRNPSKKKRSKMKLMIAVSSAIAGVCGLVTLMVFGYLHWKKETQIQTQTQKWISNKDPETRQLSLSIRTTSDKKISFEGSQDGSILDSHNTVGTTTPRKPVLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRLRRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAERVSRLVDDDEDEEDEAVIDRESTLISESSYKPLVKKSSIID

superfamily: SSF56112
IPR011009
315-623 Kinase_like
Protein kinase-like domain

DSHNTVGTTTPRKPVLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRLRRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAERVSRLVDDDE

ProfileScan: PS50011
IPR000719
324-619 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

TPRKPVLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRLRRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAERVSRLV

Gene3D: G3DSA:3.30.200.20
329-403 G3DSA:3.30.200.20

VLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFR

HMMPfam: PF07714
IPR001245
361-613 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

KGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGTCFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRLRRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAE

Gene3D: G3DSA:1.10.510.10
404-535 G3DSA:1.10.510.10

EIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLNEDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDM

Gene3D: G3DSA:1.10.510.10
567-614 G3DSA:1.10.510.10

KEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAER






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox