PRGDB00066514 (At.42765)

From PRG Wiki
Jump to: navigation, search
At.42765
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145336835 (NM_104528)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G56520) mRNA, complete cds

DNA Sequence

ATGGCTTCTTCTTCTTCCTCACCTCGCAACTGGAGATACAATGTCTTCACGAGCTTCCATGGACCAGACGTCCGTATTAAATTTCTCAGTCATTTACGTCAACAGTTTATTTACAATGGAATTACTATGTTCGATGACAACGGGATCGAAAGAAGCCAAATTATCGCTCCAGCTCTCAAAAAAGCCATTGGAGAATCGAGGATCGCGATCTTATTGCTCTCGAAGAACTATGCTTCTTCCAGTTGGTCTTTGGATGAGCTATTGGAGATTTTAAAGTGCAAAGAAGATATAGGGCAAATAGTGATGACTGTCTTCTACGAAGTTGATCCTTCTGATGTCCGCAACCAAACCGGAGATTTTGGGATTGCTTTTAAAGAAACTTGTGCTCATAAAACAGAGGAGGAGAGGCAAAAATGGACCCAAGCTTTGACCTATGTGGGCAACATTGCCGGAGAAGACTTTAAACACTGGCCCAATGAAGCTAAAATGATCGAGAAGATTGCAAGAGATGTTTCAGATATACTAAACGTCACACCGTGTAGGGATTTTGATGGCATGGTTGGACTAAACGATCATTTGAGGGAAATGGAGTCTTTGCTAGATTTAAAGAATGATGGAGTTAAGATTGTTGGAATCTCTGGTCCTGCAGGCATTGGTAAAAGTACCATTGCTACAGCTTTACATGGTCGACTCTCTAACATGTTTCAGCGTACTTGTTTTGTGGACAATCTTAGGGAAAGCTATAAGATTGGTCTTGATGAGTATCGTTTGAAGTTGCACTTACAACAGCAACTTCTTGCATATGTTTTAAATCAGGATAAAATTAGGGTGGGCCATTTAAGTGTGATGAAAGAAAGGCTTGACGACTTGAGGGTTCTTATTATTCTTGATGATGTGGAGCATCTATATCAACTAGAGGCTTTGGCTGATATCAGGTGGTTTGGTCCTGGAAGTAGGGTGATAGTGACCACTGAAAACAGAGAGATTTTGCTGCAACATGGTATCAAGGATATATACCATGTGGGTTTTCCATCAGAAGGAGAAGCTCTAATGATCTTTTGTCTATCTGCTTTTAGACAACCCTCTCCACCTTATGGTTTTTTGAAGCTTACATATGAAGTTGCAAGTATTTGTGGTAATCTTCCATTGGGTCTGCATGTTTTGGGGACGTTATTGTGGGGAAAAAGTCAGGCTGACTGGATTGAAGAACTACCAAGGTTGAAAGACTGTCTTGATGGAAGAATTGAGAGTGTATTGAAAGTTGGCTATGAGAGTTTATATGAGAAAGACCAAGCTCTTTTTCTCCTCATTGCAGTCTACTTCAATTATGATTATGTTGATTATGTGACATCCATGCTAGAAAATACTAACGTATTGGATGTTAGACTTGGGTTGAAAAAACTAGCTAATAGATGTCTTATACAAATAGATATAGACCATAATCGCAAAAGTAGAGTCGTAATGAACCGGTTGCTACAAGTAATGGCTCGAGAAGTTATTTCCAAACAAAAAATTTCCAAACGAAAGATTCTAGAAGATCCCCAGGATATTTGTTATGTTCTAGAAGAGGCAAAGGGTAAAGGATCAGCTTTAGGATTATCATTGGACGTAGCAGAGATCAAAGAATTAGTAATAAACAAAAAGGCTTTTAAAAAAATGTGCAATCTTCTCATCTTAAAAGTCTTTAATGGGACGGATCCCCGAGATAGTAAATTGCACGTACCAGAGGAGATGGAGCTTCCATCTAGCATAAGGTTACTACATTGGGAGGCATACCCGAGAAAATCTTTTAGATTTGGTCCAGAAAATCTCGTCACACTCAACATGGAGTACAGTGAGCTCGAGAAGCTATGGAAAGGAACTCAGCCACTTGCAAATCTCAAGGAGATGAACTTGTGTGGGTCATCTTGTTTGAAGGAACTCCCAGATCTTTCGAAAGCAGCAAATCTGGAGAGATTGGATGTGGCTGAGTGCAATGCTTTGGTAGAGATTCCATCCTCAGTTGCGAATCTTCACAAAATAGTTAACTTACACATGGAATCCTGTGAAAGTCTAGAAGTCATTCCAACTCTCATCAACTTGGCATCTCTTAAGATTATCAACATACATGATTGCCCACGGTTGAAAAGTTTTCCAGATGTTCCCACCAGCCTCGAGGAACTTGTGATAGAGAAAACAGGGGTACAAGAATTGCCTGCATCATTTAGGCATTGCACTGGTGTTACTACTCTTTATATATGTTCCAATAGAAATCTCAAGACCTTCTCAACACATCTCCCCATGGGTCTAAGGAAGCTAGACCTAAGCAATTGTGGTATTGAGTGGGTTACAGATAGCATCAAAGATCTTCATAATCTATATTACCTTAAACTATCAGGCTGCAAAAGACTTGTGTCTTTGCCAGAACTCCCTTGTTCGCTCGAGTGTCTATTTGCAGAGGATTGTACATCACTAGAAAGAGTAAGTGACTCTCTAAACATTCCAAATGCGCAGTTCAATTTCATCAAATGCTTCACATTGGATAGAGAAGCACGACGAGCGATTATTCAACAATCGTTTGTTCATGGGAATGTTATCTTACCAGCAAGAGAAGTACTTGAAGAAGTCGATTACCGAGCGAGAGGAAATTGCTTAACAATTCCTCCTTCTGCTTTCAACAGATTTAAGGTTTGCGTTGTGTTGTCAATTCACTAGACGATGTCGAAGAATTCGAGTCTTACAAAGCTTACGAACTAGGACTTGCATGTCATTGCAGAGTCATTGGCGACTCAGTAAAATCCGCTTCCGAGGATTTCCAACTACAAACCGTCTACACGTTCCAAACGGAACATGTCTTTATATTTGACATTAGCTTCCCATTAATTTTTAATGGACGAAAGATAATGCTCAAGTTCTTCGGTGGTTACGCTCGCATTATTGAATGTGGTGTCCAGATCTTGATGGACGAAACGGACGGAAGCAACAAAGGGTTATTTGAAAATGTAGAATGGCGTACATATAAATCCTACgaagaagcagttgaaaaagaagagtatcaatgggatacaaatcaatccgaagaagaagaagaagaTGATCTATGGGATACACATGAATCCAACGAAGCATTCGACAAAGAAGACCATGACTACGAATCTGCTCCCACCGCATATGAAGACATCTGCTTGAATCCTTCACCTAAGCTAGATCCGATTCCAAATCCAACAGCCTCATCTTCACGGCCGTTGTCTCGTTTTACTTTCCCAGATTCGGCGGCGGCGTTTGCTACCCCTCGAATAGATGATGAAGCGTCCAATAAAGACGACAATGAAGAGGGAGACAAATCTGAAATTGTGTCCGAAGACAAAGATGAAGATACCGCCCACGACGGTGACTACCAATCAATATCAAGCAAGTTGCTTCATATGTTATCTCTTTGCGTTAATTGATTTCGTTAGGCTATCTACTTGTGTGATGAACTGATGATTCTATGCTTTATGTAGACATAAACTTATTTCATGTTGCTTTTGTATTTGGCACATAAAttttttttttttAAAG


Protein sequences

Name Description Sequence
At.42765 translated coding region predicted by ESTScan from UniGene At.42765

MASSSSSPRNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVXVVNSLDDVEEFESYKAYELGLACHCRVIGDSVKSASEDFQLQTVYTFQTEHVFIFDISFPLIFNGRKIMLKFFGGYARIIECGVQILMDETDGSNKGLFENVEWRTYKSYEEAVEKEEYQWDTNQSEEEEEDDLWDTHESNEAFDKEDHDYESAPTAYEDICLNPSPKLDPIPNPTASSSRPLSRFTFPDSAAAFATPRIDDEASNKDDNEEGDKSEIVSEDKDEDTAHDGDYQSISSKLLHMLSLCVN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

MASSSSSPRNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGE

Gene3D: G3DSA:3.40.50.10140
9-143 no description

RNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQAL

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll-Interleukin receptor

WRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNI

HMMSmart: SM00255
IPR000157
12-149 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll-Interleukin receptor

VFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALT

HMMPanther: PTHR11017:SF20
35-1038 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVXVVNSLDDVEEFESYKAYELGLACHCRVIGDSVKSASEDFQLQTVYTFQTEHVFIFDISFPLIFNGRKIMLKFFGGYARIIECGVQILMDETDGSNKGLFENVEWRTYKSYEEAVEKEEYQWDTNQSEEEEEDDLWDTHESNEAFD

HMMPanther: PTHR11017
35-1038 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVXVVNSLDDVEEFESYKAYELGLACHCRVIGDSVKSASEDFQLQTVYTFQTEHVFIFDISFPLIFNGRKIMLKFFGGYARIIECGVQILMDETDGSNKGLFENVEWRTYKSYEEAVEKEEYQWDTNQSEEEEEDDLWDTHESNEAFD

superfamily: SSF52540
66-435 P-loop containing nucleoside triphosphate hydrolases

SRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFL

HMMPfam: PF00931
IPR002182
191-445 NB-ARC,NBS
NB-ARC

DHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDY

HMMSmart: SM00382
IPR003593
206-345 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

GVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPS

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

IVGISGPAGIGKSTIA

Gene3D: G3DSA:3.40.50.300
283-284 no description

MK

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLDDLRVLIILDDVE

Seg: seg
286-299 seg

RLDDLRVLIILDDV

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CGNLPLGLHVLGTLL

Seg: seg
381-394 seg

LPLGLHVLGTLLWG

superfamily: SSF52058
517-832 L domain-like,LRR

ICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQF

Gene3D: G3DSA:3.80.10.10
535-827 no description

LDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNI

HMMPfam: PF07725
IPR011713
603-622 LRR_3
Leucine-rich repeat 3

NLVTLNMEYSELEKLWKGTQ

HMMPfam: PF13504
763-774 LRR_7,Leucine rich repeat

LRKLDLSNCGIE

FPrintScan: PR00364
IPR000767
781-797 DISEASERSIST
Disease resistance protein

KDLHNLYYLKLSGCKRL

HMMPfam: PF13504
784-801 LRR_7,Leucine rich repeat

HNLYYLKLSGCKRLVSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox