PRGDB00066540 (At.43483)

From PRG Wiki
Jump to: navigation, search
At.43483
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79352580 (NM_102380)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana PERK10 (PROLINE-RICH EXTENSIN-LIKE RECEPTOR KINASE 10); ATP binding

DNA Sequence

TTCTAATAGCTCACTGTAGAGTTGGGTTTTGACTAGCAGAGGAAATTTTTGGTGAAGTGTGTGGTCTCGAAGGAAAAGCTCTTTATACAGATCCGAACAAGTTTGCATTTTTGTCATCTAATCAGATAATCTCGCTTATCTGGAATTTGCATTATTGGTGATCTGGGTTTTATCTGTTTAGTGTTGAAGCCTGTTGTCCGAGTATTTAGGGTTCAAATTATAGTACAGTGTTGAGTGATGTGTGGTTTTTAGTTGGTGCTTGGAGGTTACTGTCATACTCAAGTCTGGGAAtttttgtttcttttttgtttAATAATTTCTCTTAGTAAAGTAAGTGACGGTGTTTGTTCAATTTCAGTTTTTGATCAGAAGAGTGTTGGTGAAGAAGATGTTAGAATCTGGTCTTGGGATTTAGATGACTACACCTGCACAGGCTCCTAGGGAGGAGGTGTCACTGTCTCCATCATTGGCGTCCCCTCCACTAATGGCGTTGCCTCCACCGCAGCCTTCGTTTCCCGGTGATAATGCCACTTCCCCAACTAGAGAGCCCACTAATGGCAATCCACCAGAGACCACAAACACCCCAGCTCAGTCTTCTCCTCCTCCTGAGACTCCACTATCATCACCACCACCAGAACCTTCTCCCCCATCACCTTCACTAACTGGACCTCCTCCGACGACGATTCCAGTATCTCCTCCACCAGAACCTTCTCCCCCACCACCTTTACCAACTGAAGCTCCTCCTCCAGCGAATCCAGTATCATCACCTCCACCAGAATCTTCTCCCCCGCCACCTCCACCAACTGAAGCTCCTCCTACTACTCCTATTACATCACCCAGCCCGCCAACAAATCCACCACCACCACCGGAAAGCCCTCCTTCACTACCTGCACCAGACCCTCCAAGCAATCCACTTCCACCACCTAAGTTAGTCCCACCATCACATTCACCTCCACGTCATTTACCTTCCCCGCCAGCCTCAGAAATTCCTCCTCCTCCACGTCATTTACCTTCCCCACCAGCCTCAGAACGTCCTTCAACTCCTCCATCAGATTCAGAACATCCTTCTCCTCCTCCTCCAGGGCATCCAAAACGTCGTGAGCAACCTCCTCCACCGGGTTCTAAACGTCCTACTCCATCACCTCCTTCTCCAAGTGACTCAAAACGTCCTGTGCATCCTTCACCTCCTTCTCCACCAGAGGAAACTCTCCCACCTCCCAAGCCAAGTCCAGATCCCTTACCTTCTAATTCGTCTTCACCACCAACATTGCTTCCACCATCGTCAGTTGTATCCCCGCCTTCGCCTCCTCGAAAATCTGTGTCAGGTCCTGATAATCCATCTCCAAACAACCCCACTCCTGTGACAGATAATTCCAGCAGTTCTGGTATTAGTATAGCGGCTGTTGTGGGTGTAAGTATTGGAGTGGCCCTTGTGCTGCTTACTCTCATTGGAGTTGTTGTCTGTTGCTTAAAGAAACGGAAAAAGAGGCTCTCAACCATTGGTGGTGGCTATGTTATGCCAACACCTATGGAATCCTCCTCCCCAAGATCAGATTCAGCGCTTCTGAAGACGCAGTCATCCGCACCTCTAGTGGGAAATCGTTCTAGCAATCGTACATACTTATCACAATCAGAGCCTGGTGGTTTTGGTCAATCGAGGGAACTGTTCTCATATGAAGAACTTGTCATAGCAACAAATGGATTCTCTGATGAAAATCTCTTGGGTGAAGGTGGATTTGGTCGTGTGTATAAAGGAGTTTTACCAGATGAAAGAGTGGTTGCTGTGAAACAATTAAAAATAGGTGGAGGACAAGGTGACCGAGAGTTCAAAGCCGAGGTTGATACCATAAGCAGGGTACATCACCGGAATTTGCTTTCTATGGTTGGATACTGCATTTCCGAGAACCGGAGATTGCTTATTTATGATTATGTCCCTAACAACAACCTTTACTTCCATCTTCACGCCGCAGGAACTCCGGGTCTAGACTGGGCAACACGTGTTAAAATTGCTGCTGGTGCGGCTCGTGGACTAGCTTATCTCCATGAAGATTGTCACCCTCGTATCATACATAGGGACATCAAATCATCCAACATTCTCTTAGAAAATAACTTCCATGCCCTGGTTTCTGACTTCGGCCTTGCAAAGCTAGCTCTCGACTGTAACACACATATTACAACTCGGGTCATGGGAACATTCGGCTACATGGCTCCGGAATATGCATCAAGTGGCAAATTAACCGAGAAATCAGACGTATTCTCCTTTGGGGTTGTTCTACTGGAGTTAATCACTGGACGTAAGCCTGTGGATGCATCCCAACCTCTGGGAGATGAGAGCCTTGTTGAATGGGCTCGTCCTTTGCTTAGTAATGCCACTGAAACCGAAGAGTTTACAGCTTTAGCAGATCCCAAGCTAGGTAGAAACTATGTTGGTGTTGAAATGTTTAGAATGATTGAAGCAGCGGCAGCTTGTATTCGCCATTCAGCTACAAAGAGACCCCGAATGAGTCAAATTGTGAGAGCTTTCGACAGTCTAGCTGAGGAAGACCTCACCAATGGAATGAGACTAGGCGAAAGCGAAATAATCAACTCAGCTCAACAGTCTGCAGAAATCAGATTGTTTAGAAGAATGGCTTTTGGCAGCCAAAACTACAGTACAGATTCTTTAACTCGTAATAGTTATATAAGCAAAGATGAAAACTTGTAAATATGAGAAACAAAACACATTGCAGAATGATTTTTCTGAGGAAGAGATCTCAAAGCAGAACCTTTCTTGATTAACTTCAAATTGGGATCCTCAGTTTCCTCTCTGCCGATACTATTGCAGAAACAGCGGGTTTTGGAATATTATGTGGATGAACATATTTGC


Protein sequences

Name Description Sequence
At.43483 translated coding region predicted by ESTScan from UniGene At.43483

MTTPAQAPREEVSLSPSLASPPLMALPPPQPSFPGDNATSPTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNPTPVTDNSSSSGISIAAVVGVSIGVALVLLTLIGVVVCCLKKRKKRLSTIGGGYVMPTPMESSSPRSDSALLKTQSSAPLVGNRSSNRTYLSQSEPGGFGQSRELFSYEELVIATNGFSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSLAEEDLTNGMRLGESEIINSAQQSAEIRLFRRMAFGSQNYSTDSLTRNSYISKDENL

Domains

Domain Start-End Description Sequence

FPrintScan: PR01217
29-50 PRICHEXTENSN,Proline rich extensin signature

PQPSFPGDNATSPTREPTNGNP

FPrintScan: PR01217
56-72 PRICHEXTENSN,Proline rich extensin signature

TPAQSSPPPETPLSSPP

FPrintScan: PR01217
74-91 PRICHEXTENSN,Proline rich extensin signature

EPSPPSPSLTGPPPTTIP

FPrintScan: PR01217
98-123 PRICHEXTENSN,Proline rich extensin signature

PSPPPPLPTEAPPPANPVSSPPPESS

HMMPanther: PTHR24420
245-762 PTHR24420,FAMILY NOT NAMED

SPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNPTPVTDNSSSSGISIAAVVGVSIGVALVLLTLIGVVVCCLKKRKKRLSTIGGGYVMPTPMESSSPRSDSALLKTQSSAPLVGNRSSNRTYLSQSEPGGFGQSRELFSYEELVIATNGFSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSLAEEDLTNGMRLGESEIINSAQQSAEIRLFRRMAFGSQNYSTDSLTRNSYISKDENL

HMMPanther: PTHR24420:SF644
245-762 PTHR24420:SF644

SPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNPTPVTDNSSSSGISIAAVVGVSIGVALVLLTLIGVVVCCLKKRKKRLSTIGGGYVMPTPMESSSPRSDSALLKTQSSAPLVGNRSSNRTYLSQSEPGGFGQSRELFSYEELVIATNGFSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSLAEEDLTNGMRLGESEIINSAQQSAEIRLFRRMAFGSQNYSTDSLTRNSYISKDENL

superfamily: SSF56112
IPR011009
400-703 Kinase_like
Protein kinase-like domain

RTYLSQSEPGGFGQSRELFSYEELVIATNGFSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAF

Gene3D: G3DSA:3.30.200.20
415-506 G3DSA:3.30.200.20

RELFSYEELVIATNGFSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYV

ProfileScan: PS50011
IPR000719
430-706 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSL

HMMPfam: PF00069
IPR017442
433-701 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISRVHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVR

PatternScan: PS00107
IPR017441
436-458 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVYKGVLPDERVVAVK

Gene3D: G3DSA:1.10.510.10
509-703 G3DSA:1.10.510.10

NNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAF

PatternScan: PS00108
IPR008271
550-562 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox