PRGDB00066546 (At.43543)

From PRG Wiki
Jump to: navigation, search
At.43543
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358544 (NM_122949)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ATP binding

DNA Sequence

TCTTGGAGATCATTGATGGTTTTGTGTTTCCAAGATCCAGACAACATATATTCTCCCAAGAAGACAAAGAAAGATGATGGTGAACGTGTGATTACCAAACAGAAATCGTTTCTTGGATTGTCGATTCTAGACATAAGTAATCCAAGTTCCACTACCTTGTCCGAAGATCTCTCAATCTCCCTCGCCGGCTCGGATCTCCACGTGTTCACACAAGCAGAGCTTAGAGTCATAACACAAAGCTTCTCTTCTAGCAACTTTCTTGGTGAAGGAGGGTTTGGTCCGGTTCATAAAGGGTTCATCGATGACAAGCTCCGTCCTGGTCTTAAGGCTCAGCCCGTTGCCGTTAAACTTCTTGATCTTGATGGTCTTCAAGGTCACCGTGAGTTTATGACGGAGGTTATGTGTTTGGGAAAACTAAAGCATCCGAATCTGGTGAAGCTGATCGGATATTGCTGCGAGGAAGCACATAGACTTCTTGTTTATGAGTTCATGCCTCGTGGAAGTTTGGAGTCTCAACTCTTCAGAAGGTGCTCCCTACCGCTGCCATGGACAACGAGGTTGAACATCGCTTATGAAGCTGCAAAGGGTCTACAGTTTCTACATGAAGCCGAGAAGCCCATCATCTATCGCGATTTCAAGGCCTCTAATATCTTGTTAGATTCTGATTATACAGCGAAACTCTCGGACTTCGGGCTAGCAAAAGACGGACCACAAGGCGATGATACACATGTGTCGACTCGCGTGATGGGCACACAAGGGTACGCGGCGCCAGAGTACATAATGACAGGTCATTTAACGGCTAAGAGTGATGTGTACAGCTTTGGAGTGGTGTTGCTTGAGCTGTTGACAGGTCGGAAATCGGTGGACATAGCGAGATCATCAAGAAAAGAAACCCTCGTTGAGTGGGCTCGTCCAATGCTCAACGACGCACGTAAACTCGGGAGAATAATGGACCCGAGGCTTGAAGATCAGTACTCAGAGACCGGAGCACGAAAGGCAGCAACTCTAGCTTATCAATGCCTAAGGTACCGACCAAAGACAAGGCCAGACATTAGCACTGTTGTCTCCGTTCTCCAAGACATCAAAGATTACAAAGATGATATTCCCATTGGGATATTCACTTACACCGTTCCTACCAAGCCACGCCGGGAAGTTAAAGAGACAAGTCTTCAAAACTTTGACAAGCCACGCCGTGAAACTAAAGTGACAAGTCTTCAAAACTTCGACAAAACACGCCGTGAAGTTAAAGATACAAGTCTTCAAAACTTCGACAAAACACGCCGTGAAGTTAAAGAGACAAGTCTTCAAAACTTCGACAAAACACGCCGTGAAGTTAAAGAGACAAGTCTTCAAAACTTCGACAAGCCTCGCAACGTTTCCACGACTGATAACCATCAAAAGTTCCGGTCGCCCGCACACACGGCAAGAAACCACCGGATAACTTTGAGAAACGGATATAATTCACCAATGCGTAACGAGGCCGGAGGGGAACGGTACTGACTACTGAGTTCTCTTCTATCCTCAATTCGTAATCttttcattttttttACATAAGATGTAAATAGTAATACATTCTTACCACCAAAAAAACAA


Protein sequences

Name Description Sequence
At.43543 translated coding region predicted by ESTScan from UniGene At.43543

SWRSLMVLCFQDPDNIYSPKKTKKDDGERVITKQKSFLGLSILDISNPSSTTLSEDLSISLAGSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTVPTKPRREVKETSLQNFDKPRRETKVTSLQNFDKTRREVKDTSLQNFDKTRREVKETSLQNFDKTRREVKETSLQNFDKPRNVSTTDNHQKFRSPAHTARNHRITLRNGYNSPMRNEAGGERY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF685
30-437 PROTEIN KINASE, PUTATIVE

VITKQKSFLGLSILDISNPSSTTLSEDLSISLAGSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTVPTKPRREVKETSLQNFDKPRRETKVTSLQNFDKTRREVKDTSLQNFDKTRREVKETSLQN

HMMPanther: PTHR24420
30-437 FAMILY NOT NAMED,FAMILY NOT NAMED

VITKQKSFLGLSILDISNPSSTTLSEDLSISLAGSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTVPTKPRREVKETSLQNFDKPRRETKVTSLQNFDKTRREVKDTSLQNFDKTRREVKETSLQN

superfamily: SSF56112
IPR011009
51-366 Protein kinase-like (PK-like)
Protein kinase-like domain

TTLSEDLSISLAGSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKD

Gene3D: G3DSA:3.30.200.20
63-150 no description

GSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGY

ProfileScan: PS50011
IPR000719
81-361 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDI

HMMSmart: SM00219
IPR020635
81-358 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVL

HMMSmart: SM00220
IPR002290
81-365 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYK

HMMPfam: PF07714
IPR001245
85-358 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVL

Gene3D: G3DSA:1.10.510.10
151-356 no description

CCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVS

PatternScan: PS00108
IPR008271
207-219 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox