PRGDB00066557 (At.43892)

From PRG Wiki
Jump to: navigation, search
At.43892
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358714 (NM_123491)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT5G41260) mRNA, complete cds

DNA Sequence

TCAAAGCTCACACACACGACCACTCTATTCCTCCTTTAACCTTTGTGTTTGTCAATTTGTGTTTCCTCTTTTGTCGACTCATTTCTCGATTCAATCTCGAttttttttttttttttttttATGGAAATCTAATGAACTTTTTTTATGGATTTGATCTGTTAAAGTTTCGATTAAGAAGATAGTGGTTTAGGTTTACGGTTTTGTAATTGATTTATTATCTGTAATGGGTTGTGAGGTTTCAAAGTTATCTGCACTTTGTTGTGTTTCAGAGTCTGGAAGATCGAATCCTGATGTTACAGGCTTAGATGAGGAAGGGAGAGGTGAATCGAATGATTTGCCTCAATTTCGTGAGTTCTCTATAGAGACTATAAGGAACGCAACTTCAGGATTTGCAGCAGAGAATATAGTTTCAGAGCATGGTGAGAGAGCTCCTAATGTTGTCTATAAAGGCAAGCTTGAGAATCAAAGACGTATTGCTGTCAAAAGGTTTAACCGGAAATCTTGGCCTGATTCTCGTCAATTCTTGGAAGAAGCCAAAGCTGTTGGTCAATTACGGAATCATAGGATGGCAAATCTACTTGGGTGTTGTTATGAAGATGAAGAGAGACTACTTATTGCAGAGTTTATGCCTAATGAAACTTTGGCAAAACATCTTTTCCACTGGGAGTCACAGCCAATGAAGTGGGCGATGCGACTGAGAGTAGCTTTGCATATTGCTCAGGCGCTAGAGTATTGTACCAGCAAAGGACGTGCACTTTACCATGACCTAAATGCTTATAGAGTTCTCTTTGATGATGATGCAAATCCAAGACTTTCATGCTTTGGTTTGATGAAAAACAGTAGAGATGGAAAGAGTTATAGCACTAACCTGGCATTCACTCCTCCCGAGTATCTGAGGACAGGTCGCGTGACACCTGAAAGTGTAATATACAGCTTTGGAACTCTATTACTTGACCTTCTGAGTGGAAAGCATATACCTCCAAGCCATGCGTTGGACCTCATACGGGACAGGAACATTCAGATGCTGATGGATTCAGGTTTGGAAGGTCAATTTTCGAGTGACGATGGAACTGAATTAATAAGGTTAGCTTCAAGATGCTTGCAATATGAACCCCGAGAGCGGCCTAACCCAAAATCTTTAGTCTCTGCAATGATTCCTCTTCAGAAAGATCTTGAGATTGCTTCTCATCAATTGTTGGGCGTACCTAACAGTGCCACAACGACAGCTCTTTCACCTCTTGGCGAAGCATGCCTAAGATCAGATCTAACTGCCATACATGAGATCATTGAGAAGCTTGGATATAAGGATGACGAGGGTGCAACCACAGAGCTTTCTTTCCAGATGTGGACCGACCAGATGCAGGACACATTGGTCTTCAAGAAAAAGGGGGATTCTGCATTCCGACATAAAGACTTTGCAAAGGCCATCGAATGCTATTCTCAGTTCATCGAGGTAGGTACAATGGGTTCCCCAACTGTTCATGCAAGACAGAGTCTGTGTTACCTAATGAATGATATGCCTAGAGAAGCACTAAACAATGCAATGCAAGCACAAGTCATATCTCCTGCTTGGCATATCGCATCGTATCTCCAAGCTGTAGCTTTGTCAGCTCTAGGACAAGAGAACGAAGCACACACTGCTCTAAAAGACGGTGCAATGCTTGAAAGCAAAAGAAACCCTTTGTGATTATAAGCAACACAAAGAGGAGAAACTGGAGTACAAGAGAAATATAACCATCCTTTACGCTAACCCATACACCCGAAGAACCACTGTCGCAACATTGTATTTAAGATCAAAGCATAACAAGTCTACAGCGATTGTTCCTTTCCGAAGCCTTGATCATCACATCACATTACTGGTTAGTCTGGTTTTTATTTCAGTTTAGTGCTCCATTTTGCAAGATCCGCGGTTCAAGCCACTGTGATTATTCGATTACAGCGAGTGGACTGTGTTTATTGTTGTTGTTTAAGTTCAATGGTGCAGACGTGTTTCGTATCATAGAGAAGAAAAGAAGTGTCTATGGAGATATGATGACAAAACTTAAAAATGTATGATTGTGACATTGTGTATTATTCGCTTTAATGTAATTCAATGTTTGTATTATTGTATAGAATGAAGTATGAACCTCTCTCTGCTATAATGTTATTCCCCTCCttttttttCTTGAATTTTGCAAATGTTGAAACGCTTA


Protein sequences

Name Description Sequence
At.43892 translated coding region predicted by ESTScan from UniGene At.43892

MGCEVSKLSALCCVSESGRSNPDVTGLDEEGRGESNDLPQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVPNSATTTALSPLGEACLRSDLTAIHEIIEKLGYKDDEGATTELSFQMWTDQMQDTLVFKKKGDSAFRHKDFAKAIECYSQFIEVGTMGSPTVHARQSLCYLMNDMPREALNNAMQAQVISPAWHIASYLQAVALSALGQENEAHTALKDGAMLESKRNPL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
4-382 PTHR24420,FAMILY NOT NAMED

EVSKLSALCCVSESGRSNPDVTGLDEEGRGESNDLPQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVPNSATTTALSPLGEACLRSDLTAIHEIIEKLGYKDDEGATTELSFQMWTDQMQDT

HMMPanther: PTHR24420:SF457
4-382 PTHR24420:SF457,SUBFAMILY NOT NAMED

EVSKLSALCCVSESGRSNPDVTGLDEEGRGESNDLPQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVPNSATTTALSPLGEACLRSDLTAIHEIIEKLGYKDDEGATTELSFQMWTDQMQDT

superfamily: SSF56112
IPR011009
28-333 Kinase_like
Protein kinase-like domain

DEEGRGESNDLPQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVPNSATT

Gene3D: G3DSA:3.30.200.20
40-122 G3DSA:3.30.200.20

QFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCC

ProfileScan: PS50011
IPR000719
59-325 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLL

HMMPfam: PF07714
IPR001245
72-308 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVS

Gene3D: G3DSA:1.10.510.10
123-304 G3DSA:1.10.510.10

YEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPK

superfamily: SSF48452
373-475 SSF48452

QMWTDQMQDTLVFKKKGDSAFRHKDFAKAIECYSQFIEVGTMGSPTVHARQSLCYLMNDMPREALNNAMQAQVISPAWHIASYLQAVALSALGQENEAHTALK

Gene3D: G3DSA:1.25.40.10
IPR011990
381-480 TPR-like_helical
Tetratricopeptide-like helical

DTLVFKKKGDSAFRHKDFAKAIECYSQFIEVGTMGSPTVHARQSLCYLMNDMPREALNNAMQAQVISPAWHIASYLQAVALSALGQENEAHTALKDGAML

HMMPfam: PF13414
383-448 TPR_11,TPR repeat

LVFKKKGDSAFRHKDFAKAIECYSQFIEVGTMGSPTVHARQSLCYLMNDMPREALNNAMQAQVISP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox