PRGDB00066568 (At.45988)

From PRG Wiki
Jump to: navigation, search
At.45988
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 26452612 (AK118799)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At4g23270 mRNA for putative serine

DNA Sequence

ACATTATCTGAAACCCAGATCGAGGAAAAGGAACCATGTCTTCTCTGATCTCTTTCATCTTCCTTTTCCTTTTCTCATCCATCACAGCTTCTGCTCAAAATACTTTCTACCTATATCATAATTGTTCAGTCACGACGACTTTCTCAAGTAACAGCACTTACTCCACCAATCTCAAAACCCTTTTGTCCTCTCTCTCTTCCCTTAACGCTTCTTCTTACTCCACCGGATTCCAAACCGCCACGGCGGGACAGGCCCCCGACAGGGTCACCGGACTTTTCCTCTGCCGCGTCGACGTCTCGTCGGAAGTTTGCCGTAGCTGCGTCACCTTTGCCGTAAACGAAACGTTGACTCGGTGTCCAAAAGATAAAGAAGGCGTGTTCTATTACGAGCAGTGTCTGCTCAGATACTCTAACAGGAATATAGTAGCCACTCTAAACACCGATGGAGGAATGTTCATGCAGAGCGCTAGGAATCCTCTATCAGTCAAACAAGATCAGTTCAGAGATTTGGTCTTGACCCCCATGAACTTAGCCGCCGTTGAAGCCGCCAGGAGTTTCAAAAAATGGGCTGTGAGAAAAATTGATTTAAATGCATCCCAGAGTTTGTACGGAATGGTTCGGTGCACTCCTGATCTTAGGGAACAAGACTGCTTAGACTGTCTGAAAATAGGCATCAATCAAGTAACCTATGACAAAATTGGGGGAAGGATTCTTCTGCCGAGCTGTGCTTCAAGATACGATAATTACGCGTTTTACAACGAATCTAATGTTGGAACACCTCAAGATTCATCACCACGTCCTGGAAAAGGTGGAAACTCCTCTGTCATAATTATTGCAGTTGTTGTTCCAATCACTGTACTTTTTCTTCTATTAGTAGCTGTTTTTAGTGTCAGGGCTAAAAATAAGAGGACGCTTAATGAGAAGGAACCAGTAGCTGAAGTTTTCTTTTCCAGATGGGAATGATATTACGACTGCAGGATCACTTCAGTTTGATTTTAAGGCAATTGAGGCAGCAACGAATTGCTTTTTGCCAATTAACAAGCTAGGTCAAGGTGGTTTCGGCGAAGTTTACAAGGGTACATTGAGTAGTGGACTACAAGTTGCGGTGAAGAGACTATCGAAGACATCAGGACAAGGTGAAAAAGAGTTTGAAAACGAAGTTGTTGTTGTTGCAAAGCTCCAACATAGAAATTTGGTAAAGCTGCTTGGTTATTGTTTGGAAGGAGAAGAAAAAATACTTGTCTACGAGTTTGTGCCCAACAAGAGCCTTGATCACTTCCTCTTTGACTCTACGATGAAAATGAAGCTAGACTGGACAAGAAGGTACAAGATCATAGGAGGAATTGCTAGAGGAATTCTTTATCTTCATCAAGATTCACGACTCACAATTATACATCGAGACCTCAAAGCAGGGAACATCCTCTTGGATGATGATATGAATCCTAAAATTGCAGATTTTGGAATGGCGAGAATATTTGGGATGGACCAAACAGAAGCCATGACAAGAAGAGTAGTTGGAACTTATGGATACATGTCTCCCGAGTATGCGATGTACGGCCAATTCTCCATGAAATCAGATGTGTACAGTTTTGGCGTCTTAGTACTTGAGATTATAAGCGGCATGAAGAATAGTAGTCTCTATCAAATGGATGAAAGTGTTGGCAACTTGGTTACATATACTTGGAGACTATGGAGCAATGGGTCGCCATCAGAGCTTGTAGATCCGTCATTTGGAGATAATTATCAAACAAGCGAAATTACTAGGTGCATCCATATCGCTTTACTATGTGTTCAGGAAGATGCTGAAGATCGTCCAACCATGTCATCGATAGTTCAAATGCTCACTACTAGCTTGATCGCTCTCGCTGAGCCTAGACCACCTGGATTTTTCTTCCGAAGCAAGCAGGAACAAGCAGGTCCACCTATTGATTCATCTACGCATTGTTCAGTCGACGAAGCTTCCATTACTCGTGTAACTCCTCGTTGAAGACAAAACTATTCGTTAATCTAAACATTTGTGATATATGATTTTAGACTATTAAGATCGACAGTGAACAAAAATTCATGTAAGTTAAACTGGTTTTATTGTTTATTTTCTTTATAAATTCTTTAATTAAC


Protein sequences

Name Description Sequence
At.45988 translated coding region predicted by ESTScan from UniGene At.45988

MSSLISFIFLFLFSSITASAQNTFYLYHNCSVTTTFSSNSTYSTNLKTLLSSLSSLNASSYSTGFQTATAGQAPDRVTGLFLCRVDVSSEVCRSCVTFAVNETLTRCPKDKEGVFYYEQCLLRYSNRNIVATLNTDGGMFMQSARNPLSVKQDQFRDLVLTPMNLAAVEAARSFKKWAVRKIDLNASQSLYGMVRCTPDLREQDCLDCLKIGINQVTYDKIGGRILLPSCASRYDNYAFYNESNVGTPQDSSPRPGKGGNSSVIIIAVVVPITVLFLLLVAVFSVRAKNKRTLNEKEPELKFSFPDGNDITTAGSLQFDFKAIEAATNCFLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQMLTTSLIALAEPRPPGFFFRSKQEQAGPPIDSSTHCSVDEASITRVTPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF430
1-640 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MSSLISFIFLFLFSSITASAQNTFYLYHNCSVTTTFSSNSTYSTNLKTLLSSLSSLNASSYSTGFQTATAGQAPDRVTGLFLCRVDVSSEVCRSCVTFAVNETLTRCPKDKEGVFYYEQCLLRYSNRNIVATLNTDGGMFMQSARNPLSVKQDQFRDLVLTPMNLAAVEAARSFKKWAVRKIDLNASQSLYGMVRCTPDLREQDCLDCLKIGINQVTYDKIGGRILLPSCASRYDNYAFYNESNVGTPQDSSPRPGKGGNSSVIIIAVVVPITVLFLLLVAVFSVRAKNKRTLNEKEPELKFSFPDGNDITTAGSLQFDFKAIEAATNCFLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQMLTTSLIALAEPRPPGFFFRSKQEQAGPPIDSSTHCSVDE

HMMPanther: PTHR24420
1-640 FAMILY NOT NAMED,FAMILY NOT NAMED

MSSLISFIFLFLFSSITASAQNTFYLYHNCSVTTTFSSNSTYSTNLKTLLSSLSSLNASSYSTGFQTATAGQAPDRVTGLFLCRVDVSSEVCRSCVTFAVNETLTRCPKDKEGVFYYEQCLLRYSNRNIVATLNTDGGMFMQSARNPLSVKQDQFRDLVLTPMNLAAVEAARSFKKWAVRKIDLNASQSLYGMVRCTPDLREQDCLDCLKIGINQVTYDKIGGRILLPSCASRYDNYAFYNESNVGTPQDSSPRPGKGGNSSVIIIAVVVPITVLFLLLVAVFSVRAKNKRTLNEKEPELKFSFPDGNDITTAGSLQFDFKAIEAATNCFLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQMLTTSLIALAEPRPPGFFFRSKQEQAGPPIDSSTHCSVDE

Seg: seg
2-16 seg

SSLISFIFLFLFSSI

ProfileScan: PS51473
24-129 GNK2,Gnk2-homologous domain profile.

FYLYHNCSVTTTFSSNSTYSTNLKTLLSSLSSLNASSYSTGFQTATAGQAPDRVTGLFLCRVDVSSEVCRSCVTFAVNETLTRCPKDKEGVFYYEQCLLRYSNRNI

HMMPfam: PF01657
IPR002902
27-126 Stress-antifung
Gnk2-homologous domain

YHNCSVTTTFSSNSTYSTNLKTLLSSLSSLNASSYSTGFQTATAGQAPDRVTGLFLCRVDVSSEVCRSCVTFAVNETLTRCPKDKEGVFYYEQCLLRYSN

Seg: seg
31-63 seg

SVTTTFSSNSTYSTNLKTLLSSLSSLNASSYST

ProfileScan: PS51473
135-239 GNK2,Gnk2-homologous domain profile.

TDGGMFMQSARNPLSVKQDQFRDLVLTPMNLAAVEAARSFKKWAVRKIDLNASQSLYGMVRCTPDLREQDCLDCLKIGINQVTYDKIGGRILLPSCASRYDNYAF

HMMPfam: PF01657
IPR002902
163-239 Stress-antifung
Gnk2-homologous domain

MNLAAVEAARSFKKWAVRKIDLNASQSLYGMVRCTPDLREQDCLDCLKIGINQVTYDKIGGRILLPSCASRYDNYAF

Seg: seg
263-285 seg

VIIIAVVVPITVLFLLLVAVFSV

superfamily: SSF56112
IPR011009
302-625 Protein kinase-like (PK-like)
Protein kinase-like domain

FSFPDGNDITTAGSLQFDFKAIEAATNCFLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQMLTTSLIALAEPRPPGFFFRSKQEQ

Gene3D: G3DSA:3.30.200.20
317-392 no description

QFDFKAIEAATNCFLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGY

ProfileScan: PS50011
IPR000719
330-607 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQMLTTSLI

HMMSmart: SM00220
IPR002290
330-607 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQMLTTSLI

HMMSmart: SM00219
IPR020635
330-602 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FLPINKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQML

HMMPfam: PF07714
IPR001245
334-602 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NKLGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQML

PatternScan: PS00107
IPR017441
336-358 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGEVYKGTLSSGLQVAVK

Gene3D: G3DSA:1.10.510.10
393-602 no description

CLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAEDRPTMSSIVQML

PatternScan: PS00108
IPR008271
451-463 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKAGNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox