PRGDB00066582 (At.47555)

From PRG Wiki
Jump to: navigation, search
At.47555
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22654963 (AY139753)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT5g43470

DNA Sequence

GTTGTTGCTGTCTCCTCTCTCAATGGCTACCTCCTGCGACTGAAACGAGTTCAGGCAGCAATGTAAATGAGCTGGAGAATATAAGCAATGATAGGACTGAGTCAATAGTTCAAGAACGTGAAGAGAATCTGTACCCTTGGCGTTCTTGTACTGGTTCATCGTAGATGATTCTCGACGACTAGTTGTTATGGCTGAAGCATTTGTGTCGTTTGGACTTGAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGGGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGTTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAATTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGTGGAAAAGGAAAAGGGGTCAAGAAGCATGTGAGACGACTTGCTTGCTTCTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAGAGGATCTCTGAAGTGATTGGGGAAATGCAGAGTTTTGGGATACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGTGCAGAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAAAGCGATCTTGTCGGGGTGGAGCAGAGTGTTAAAGAATTGGTTGGTCATTTGGTGGAGAATGATGTTCATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGTAAAACCACTCTGGCTAGACAAGTCTTTCATCATGACTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCCCAACAATTTACACAGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGGATATTTTACAGATGGACGAATATGCACTTCAGCGTAAACTCTTTCAATTGTTAGAGGCCGGTAGATATTTAGTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATGTAATAAAAGCAGTGTTTCCACGGAAAAGAGGTGAGCTCTTATGGTACATACATGAAGCACTTTTTCTTCTTAATTCATAAAAGTGATTGTTAAAAAAGAAATATATAGAATAATTGCCTTTTTTATTCCCTAGCATGAGAAACACAAATATTTTTGCAGGTTGGAAGATGCTGCTTACTTCTCGAAATGAAGGTGTTGGGATACATGCTGATCCAACATGTTTAACTTTTAGAGCAAGCATCCTTAACCCTGAAGAAAGTTGGAAGCTCTGTGAGAGAATAGTATTCCCTAGGAGAGATGAAACTGAAGTAAGGCTTGATGAAGAAATGGAAGCCATGGGAAAGGAAATGGTCACACATTGTGGAGGACTACCATTAGCTGTTAAAGCGTTGGGAGGCTTGTTAGCTAATAAACATACTGTTCCTGAGTGGAAAAGAGTTTTTGACAATATTGGATCTCAAATAGTAGGAGGATCGTGGTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTCTGAGTTATGAAGATTTGCCAACGCATTTAAAGCATTGCTTCCTTAACCTAGCCCATTTCCCCGAAGATTCCGAGATATCTACGTATAGTTTGTTCTATTACTGGGCTGCAGAAGGGATTTACGATGGATCAACCATCGAAGATAGTGGAGAATACTACCTAGAAGAGCTAGTGAGGAGAAATTTGGTTATTGCAGACGACAACTATTTGAGTTGGCAATCTAAATATTGTCAAATGCATGACATGATGAGAGAAGTATGTTTATCTAAAGCCAAAGAAGAGAACTTCCTACAAATTATCATAGACCCTACTTGCACCTCTACCATCAATGCTCAATCTCCTAGTAGATCTCGCAGACTCAGCATACATAGTGGTAAAGCCTTTCATATATTGGGACACAAAAACAAGACAAAGGTGAGATCTCTTATAGTTCCGAGATTCGAGGAAGACTATTGGATACGATCAGCTTCAGTCTTCCACAACTTAACATTGCTCAGGGTGTTGGATCTTTCTTGGGTAAAGTTTGAAGGAGGGAAGTTACCTTGTAGCATTGGAGGGCTCATCCACTTGAGATACTTGAGTTTATACGAGGCTAAGGTATCTCATCTACCTTCTACTATGCGGAACCTAAAGCTTCTGCTCTATTTGAACTTACGTGTTGATACCGAGGAACCGATTCACGTGCCAAATGTTTTGAAAGAGATGATACAGTTGAGGTACCTTTCCCTACCTCTTAAAATGGATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTATGGTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACTAAGCTCCGGTATCTCGCTGTATCTTTGAGCGAAAGGTGCAATTTTGAAACTCTATCGTCATCTCTCCGCGAATTGCGAAACCTCGAGACGCTTAATTTCCTTTTTTCGCTCGAAACATATATGGTTGATTATATGGGAGAGTTTGTTCTGGATCATTTTATTCATCTAAAACAGTTGGGATTGGCAGTACGTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTGTACACTTATTTCTAATTTATTGCGGCATGGAAGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATTTGAAGTCGGTTCGTTTAGCACGTAAGGCATTCCTAGGGAGCAGAATGGTGTGCTCAAAAGGCGGATTTCCTCAATTATGTGTTATAGAAATATCTAAAGAATCAGAGTTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTTTGACTATAGATGATTGCAAAAAGTTGAAGGAACTTCCAGATGGACTCAAGTACATAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAACTGGTACCAGGTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTATCAACTGTGACCAGTAGCAGATGCAGGAAAGACCAAGAAGCGAGCCAAATTCTCTTATATTGGGAGATATAGACGCTGCTTCAACAGAGTCATCTGCTGATCAACAGGTTTTTCCGAAGAATATCTGGTATTGCTTATGAAGAATACAGATTCTCAAGTATTAACGATTATGTTTCCAGTCTTGGAGCTCTCGCTTTTTCAGTGCATCGTTATGTTGTGCGGCTCAGAACTATATTATAGAAACAATGCTTATATTGTTGTTTGTTTTTGATGTGGATGCATGGAACATGCTTGAGAACTCTTTTACAAAATGGAGAAACGAAACTTGTAAAATttggatattttatgtttgttgtaaaatttggatattttgtgtttgtgtaaaatttggatattATATGTTTTGCTTTCCC


Protein sequences

Name Description Sequence
At.47555 translated coding region predicted by ESTScan from UniGene At.47555

XCCCLLSQWLPPATETSSGSNVNELENISNDRTESIVQEREENLYPWRSCTGSSVDDSRRLVVMAEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFLLXFIKVIVKKEIYRKLPFLFPSMRNTNIFAGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQXQMQERPRSEPNSLILGDIDAASTESSADQQVFPKNIWYCL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
65-1039 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFLLXFIKVIVKKEIYRKLPFLFPSMRNTNIFAGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQXQMQERPRSEPNSLILGDIDAASTE

HMMPanther: PTHR23155
65-1039 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFLLXFIKVIVKKEIYRKLPFLFPSMRNTNIFAGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQXQMQERPRSEPNSLILGDIDAASTE

Coil: coil
87-115 coiled-coil

LQGIDGQLDGLKRQLRSLQSLLKDADAKK

Seg: seg
97-109 seg

LKRQLRSLQSLLK

Seg: seg
143-161 seg

VLNKLSGKGKGVKKHVRRL

Seg: seg
207-218 seg

QERQRVQREIRQ

superfamily: SSF52540
211-502 P-loop containing nucleoside triphosphate hydrolases

RVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFLLXFIKVIVKKEIYRKLPFLFPSMRNTNIFAGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVG

HMMPfam: PF00931
IPR002182
232-355 NB-ARC,NBS
NB-ARC

EQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKR

Gene3D: G3DSA:3.40.50.300
233-341 no description

QSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKK

FPrintScan: PR00364
IPR000767
250-265 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
325-339 DISEASERSIST
Disease resistance protein

LLEAGRYLVVLDDVW

HMMPfam: PF00931
IPR002182
398-561 NB-ARC,NBS
NB-ARC

AGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYD

FPrintScan: PR00364
IPR000767
466-480 DISEASERSIST
Disease resistance protein

CGGLPLAVKALGGLL

superfamily: SSF52058
597-982 L domain-like,LRR

QMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEG

Seg: seg
728-737 seg

NLKLLLYLNL

Seg: seg
815-835 seg

FETLSSSLRELRNLETLNFLF

Gene3D: G3DSA:3.80.10.10
880-982 no description

HLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEG

FPrintScan: PR00364
IPR000767
946-962 DISEASERSIST
Disease resistance protein

GSMPCLRTLTIDDCKKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox