PRGDB00066621 (At.49802)

From PRG Wiki
Jump to: navigation, search
At.49802
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358185 (NM_121875)
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana EMB3013 (embryo defective 3013); ATP binding

DNA Sequence

ATGAATCAGTACCACATCTACGAAGCTATTGGACATGGCAAATGCTCGACTGTGTATAAAGGAAGGAAGAAGAAGACGATCGAGTATTTTGCCTGCAAGAGTGTCGATAAGTCGCGGAAGAACAAGGTTCTTCAAGAGGTCAGGATCCTTCACTCGCTAAATCATCCAAACGTACTCAAGTTCTATGCTTGGTATGAAACTTCTGCTCACATGTGGTTAGTTCTGGAATATTGCGTTGGTGGTGATCTCAGGACATTATTGCAGCAGGACTGTAAACTGCCAGAAGAATCTATCTATGGTCTTGCTTATGATCTTGTCATAGCCCTGCAGTATTTACATTCGAAAGGAATTATATATTGTGATCTGAAACCATCAAACATCTTACTTGATGAAAATGGGCATATTAAGCTGTGTGATTTTGGTTTGTCAAGGAAGCTGGATGATATTTCTAAATCTCCTTCCACGGGAAAACGTGGTACCCCGTATTATATGGCTCCAGAGCTATATGAAGATGGAGGGATCCATTCTTTTGCTTCTGATCTGTGGGCACTTGGTTGTGTACTATATGAATGTTACACAGGAAGACCTCCTTTTGTGGCAAGAGAGTTTACCCAGCTTGTGAAATCTATTCATTCAGATCCAACTCCTCCACTCCCTGGAAATGCTAGTCGTTCATTTGTCAATCTCATTGAGTCTCTTCTTATCAAAGACCCAGCTCAAAGAATACAATGGGCAGATCTCTGTGGTCATGCATTTTGGAAGAGTAAGATAAATTTAGTTCAGTTGCCTACTCAGCCTGCTTTTGATGATATGATTGGCATAAACACAAAGCCATGCCTTTCCGAGCGTAATGGAGATAGACCAAATAAGACCCCTCCAAAGTACCGGGAGAAAGATCGAAAAGGGGGTTCAAAGCAAAATGAGAACTCCATTCAAGGTTCAAAAGGCCATGAGACGCCGATAAAGGGCACCCCTGGTGGGTCTAAAGCTCAAGCAAAGCTTCCTAGTAGAGCAACTGAGGAAAAGCATGGAGGTCGTCCTGCTGCTAACAGACAGGTGAATATTCTAAGATTGTCAAGGATAGCAAAGGCAAATCTTCAAAAGGAAAATGAGAAGGAAAACTATAGGAGACCCTTACCTAATAGCAACGAGAATTGTGCAGAAGTGAAGATCGACAACACTGATATGGAACTTGATTTTGATGAAAACAATGATGATGAGGGACCTGATGAATCAGAAGGAACCGAAAACACCTCTTGTGCACAAGAAGAAAGAGTAATGAGCCATAATGAGAATCACAGAAGACAAAGAGTTGTAAGCAGTAATGTGCCTGATGAGAACTCGTCTGCAAATGAAACACCAACCTTGGGTGAAGCAAGAGATTGCCATGAAGATCAGTCAGAGCCAATGGACATGTCAGCTGCCCCACCTAGTGCTAGTCCTCAACTTAAAACTCACCGAGGAAGAGAAACTTCTGGGGTTGCTGTTAATCATGACTCATCTAAAGCACCTACTAGCCTCACTGACGTCTTTTGGCATATATCTGATCTTTCTGTTAGGCCTGTCATGCCCAGCAGAAAATCTGACAAAGAAGCTGTGCATTCTCTCTCATTCGAAACACCACAGCCCTCTGATTTTAGTAAGAAGGGAAAGCAAGAATTAGAACCGCTGAACAATAGGATCATAACAGTTCTAAGTGGGAGCAGTTCTGGACTGTCAGAGAAACAGAATTTGATCAGATACCTCGAGACATTGAGTACCAATGCTGATGCAGCCAACATCCTGACTAACGGACCAATAATGCTTGTGCTTGTTAAAGTTCTGAGATTATCCAAGACCCCAGCATTTCGTGTACAAATTGCTTCACTAATTGGTTTGTTAATTCGGCATTCTACTTCAATCGAAGATGACTTGGCAAATTCTGGTATTTTAGACTCTCTTACTAATGGCCTCAGAGACAAGCATGAGAAAGTGAGAAGATTCTCTATGGCAGCTCTAGGTGAATTGCTATTCTACATCTCAACTCAAAATGAGCATAAGGATTTCAAACCACCAGAATCCCCATCAAAAGAAACCCGGTCTGCATCGGGTTGGCAGGTTTCAAATGCCTTGATCTCTCTTGTATCATCTGTCTTACGGAAGGGAGAAGATGACCTGACTCAGGTTTATGCGTTAAGGACAATAGAAAACATCTGCAGTCAAGGAGCTTACTGGGCCACCCGTTTCTCCAGCCAGGATTTGATTAGCAACCTCTGCTATATCTACAAGGCAACGGGGAAACAGGAGAGCATGAGGCAAACTGCTGGATCCTGTTTAGTCCGTCTTGCTCGCTTTAACCCTCCTTGCATTCAGACGGTCGTGGAAAAGCTTTCATTGAAGGAAATAGCTTCATCTTTTGTCAAAGGCAGCGCAAGAGAGCAGCAAGTCTGCTTAAATCTTCTGAACATGGCTATGATTGGAAGTCATACATTCACAAGCTTTGGAAGGCATCTCGTGACATTGACAGAGGAGAAGAACCTTTTCCCTAGTTTACTCTCCATCATAGAGCAAGGAACAGAAGTTCTGAGGGGCAAAGCTCTTCTCTTTGTTGCATTTCTCTGCAAAAACAGTAGGCGTTGGCTGACAAATTTCTTCTGCAATGCAAGATTTCTTCCTGTGGTGGACAGATTAGCTAAAGAAAAAGACAGTTACCTGCAACAATGTCTTGAGGCATTTGTGAATGTAATCGCCTCCATAATACCGGGCATGCTGGATACAATAACCAATGATATCCAACAACTGATGACAGGAAGACGCCATGGACCTGTCTCTCCCCTTAATAGTCGAGCTCCTGTAAAGACTAATGCACACCTGTTCCCTGTGGTTCTTCACCTTCTGGGAAGCTCTTCGTTTAAGAACAAGATGGTAACTCCACAAGTCCTAAGGCAGTTGGCAAATCTTACAAAACTTGTGGAAGCATCGTTTCAGGGAAGAGATGACTTCCGTGTAACCCTTCTTCAAGTTCTAGAGTGCATAACAGGAGATGCGCCTCTGGTTACACAAAATGGTGAGATTATTATCCGTGAGATTCTCCCATCTCTGGCTGCAATTTACAATGGAAACAAAGACGGTGATGCTCGGTTTCTCTGTTTGAAAATCTGGTTCGATTCATTGACCATTCTCTTAACTGAGTGCACCGAAATCGAGCAACAAATATCGGAGGATTTGAAATCAATATCCAACTCTCATTTCCTCCCACTCTACCCTGCACTGATCCAAGACGAAGATCCAATCCCAGCTTACGCTCAAAAGCTCCTTGTCATGCTCGTTGAGTTTGATTACATCAAAATCTCCAACTTATTGCGTCACAATACGGTTTCACAATGCTTCGAGTTTCTTCTCGGAGACTTATCAAGCGCAAATGTGAACAATGTCAAGCTCTGTCTCGCCTTGGCTTCAGCTCCAGAGATGGAAAGTAAACTACTCTCTCAGCTCAAAGTAGTGAGGAGAATCGGAAATCTGCTGGAATTCGTGAATGCCAAAGATATGGAAGATTTCCTAGAACCCACTTTAAGTCTCTGCAGAGCTTTTCTGCTACGGTCACTTGGGAACAAGAAAGGTCTCAGTTCCAACTACACAAAAGAGCCAACGCTTTTATCAGAGGCATCTTTTACGTTCGAGGTTGATCCACAGGAATGCATAAGAGACATTGCAGATTTCGGTAGCAACATTGGCCTATTCTTGCACTTTGCAGGCTTAGACGATGACACAAGCATCGCAGTCGCAGATATTGCCTCTGAATGTGTTGTGTTGCTACTCAAAGCGGCTTCGAGAGAAGCCACGACGGGATTCTTAACCAATCTTCCTAAGATCACACCGATTCTGGACTCGTGGCGCAGGAGGAAGAGCACAGAGCTACACTTGTTGGTTCTGAAGAGAGTCTTGCATTGTTTGGGTTATGCTTGCAAGCAGTATCTATCGCAGGCGATGATTTTGTCGATATCGGGACACGATGTCTCAAAGATCAACGCAATTGTCTCTGAGATGAAGAACTCAGACGCCGCTGGTCTTAACAGCATCGCTTCACTCGTTGCCATGGAGTTGCAGAGATTACCTCGTTGAATTTGAAGTCATCTGAACAATGGATTAACGACGACAATGACGCTGAGCTGTAGATTTTGAGTACATGCGAGGTAAAACAAACGCAAAAACATGTGACAAAGTGAAACCCAGAATCAAGATTTGTCTCTTCTTAATGTATATTTCTTTCTATTGCAATTTTTGTACCACTAATACAATCTACTTCCTTAATATTATCTTCTTTTAGAC


Protein sequences

Name Description Sequence
At.49802 translated coding region predicted by ESTScan from UniGene At.49802

MNQYHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFWKSKINLVQLPTQPAFDDMIGINTKPCLSERNGDRPNKTPPKYREKDRKGGSKQNENSIQGSKGHETPIKGTPGGSKAQAKLPSRATEEKHGGRPAANRQVNILRLSRIAKANLQKENEKENYRRPLPNSNENCAEVKIDNTDMELDFDENNDDEGPDESEGTENTSCAQEERVMSHNENHRRQRVVSSNVPDENSSANETPTLGEARDCHEDQSEPMDMSAAPPSASPQLKTHRGRETSGVAVNHDSSKAPTSLTDVFWHISDLSVRPVMPSRKSDKEAVHSLSFETPQPSDFSKKGKQELEPLNNRIITVLSGSSSGLSEKQNLIRYLETLSTNADAANILTNGPIMLVLVKVLRLSKTPAFRVQIASLIGLLIRHSTSIEDDLANSGILDSLTNGLRDKHEKVRRFSMAALGELLFYISTQNEHKDFKPPESPSKETRSASGWQVSNALISLVSSVLRKGEDDLTQVYALRTIENICSQGAYWATRFSSQDLISNLCYIYKATGKQESMRQTAGSCLVRLARFNPPCIQTVVEKLSLKEIASSFVKGSAREQQVCLNLLNMAMIGSHTFTSFGRHLVTLTEEKNLFPSLLSIIEQGTEVLRGKALLFVAFLCKNSRRWLTNFFCNARFLPVVDRLAKEKDSYLQQCLEAFVNVIASIIPGMLDTITNDIQQLMTGRRHGPVSPLNSRAPVKTNAHLFPVVLHLLGSSSFKNKMVTPQVLRQLANLTKLVEASFQGRDDFRVTLLQVLECITGDAPLVTQNGEIIIREILPSLAAIYNGNKDGDARFLCLKIWFDSLTILLTECTEIEQQISEDLKSISNSHFLPLYPALIQDEDPIPAYAQKLLVMLVEFDYIKISNLLRHNTVSQCFEFLLGDLSSANVNNVKLCLALASAPEMESKLLSQLKVVRRIGNLLEFVNAKDMEDFLEPTLSLCRAFLLRSLGNKKGLSSNYTKEPTLLSEASFTFEVDPQECIRDIADFGSNIGLFLHFAGLDDDTSIAVADIASECVVLLLKAASREATTGFLTNLPKITPILDSWRRRKSTELHLLVLKRVLHCLGYACKQYLSQAMILSISGHDVSKINAIVSEMKNSDAAGLNSIASLVAMELQRLPR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
1-106 G3DSA:3.30.200.20

MNQYHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLV

HMMPanther: PTHR24360
1-1366 PTHR24360,MAPKK/MEKK

MNQYHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFWKSKINLVQLPTQPAFDDMIGINTKPCLSERNGDRPNKTPPKYREKDRKGGSKQNENSIQGSKGHETPIKGTPGGSKAQAKLPSRATEEKHGGRPAANRQVNILRLSRIAKANLQKENEKENYRRPLPNSNENCAEVKIDNTDMELDFDENNDDEGPDESEGTENTSCAQEERVMSHNENHRRQRVVSSNVPDENSSANETPTLGEARDCHEDQSEPMDMSAAPPSASPQLKTHRGRETSGVAVNHDSSKAPTSLTDVFWHISDLSVRPVMPSRKSDKEAVHSLSFETPQPSDFSKKGKQELEPLNNRIITVLSGSSSGLSEKQNLIRYLETLSTNADAANILTNGPIMLVLVKVLRLSKTPAFRVQIASLIGLLIRHSTSIEDDLANSGILDSLTNGLRDKHEKVRRFSMAALGELLFYISTQNEHKDFKPPESPSKETRSASGWQVSNALISLVSSVLRKGEDDLTQVYALRTIENICSQGAYWATRFSSQDLISNLCYIYKATGKQESMRQTAGSCLVRLARFNPPCIQTVVEKLSLKEIASSFVKGSAREQQVCLNLLNMAMIGSHTFTSFGRHLVTLTEEKNLFPSLLSIIEQGTEVLRGKALLFVAFLCKNSRRWLTNFFCNARFLPVVDRLAKEKDSYLQQCLEAFVNVIASIIPGMLDTITNDIQQLMTGRRHGPVSPLNSRAPVKTNAHLFPVVLHLLGSSSFKNKMVTPQVLRQLANLTKLVEASFQGRDDFRVTLLQVLECITGDAPLVTQNGEIIIREILPSLAAIYNGNKDGDARFLCLKIWFDSLTILLTECTEIEQQISEDLKSISNSHFLPLYPALIQDEDPIPAYAQKLLVMLVEFDYIKISNLLRHNTVSQCFEFLLGDLSSANVNNVKLCLALASAPEMESKLLSQLKVVRRIGNLLEFVNAKDMEDFLEPTLSLCRAFLLRSLGNKKGLSSNYTKEPTLLSEASFTFEVDPQECIRDIADFGSNIGLFLHFAGLDDDTSIAVADIASECVVLLLKAASREATTGFLTNLPKITPILDSWRRRKSTELHLLVLKRVLHCLGYACKQYLSQAMILSISGHDVSKINAIVSEMKNSDAAGLNSIASLVAMELQRLPR

HMMPanther: PTHR24360:SF96
1-1366 PTHR24360:SF96

MNQYHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFWKSKINLVQLPTQPAFDDMIGINTKPCLSERNGDRPNKTPPKYREKDRKGGSKQNENSIQGSKGHETPIKGTPGGSKAQAKLPSRATEEKHGGRPAANRQVNILRLSRIAKANLQKENEKENYRRPLPNSNENCAEVKIDNTDMELDFDENNDDEGPDESEGTENTSCAQEERVMSHNENHRRQRVVSSNVPDENSSANETPTLGEARDCHEDQSEPMDMSAAPPSASPQLKTHRGRETSGVAVNHDSSKAPTSLTDVFWHISDLSVRPVMPSRKSDKEAVHSLSFETPQPSDFSKKGKQELEPLNNRIITVLSGSSSGLSEKQNLIRYLETLSTNADAANILTNGPIMLVLVKVLRLSKTPAFRVQIASLIGLLIRHSTSIEDDLANSGILDSLTNGLRDKHEKVRRFSMAALGELLFYISTQNEHKDFKPPESPSKETRSASGWQVSNALISLVSSVLRKGEDDLTQVYALRTIENICSQGAYWATRFSSQDLISNLCYIYKATGKQESMRQTAGSCLVRLARFNPPCIQTVVEKLSLKEIASSFVKGSAREQQVCLNLLNMAMIGSHTFTSFGRHLVTLTEEKNLFPSLLSIIEQGTEVLRGKALLFVAFLCKNSRRWLTNFFCNARFLPVVDRLAKEKDSYLQQCLEAFVNVIASIIPGMLDTITNDIQQLMTGRRHGPVSPLNSRAPVKTNAHLFPVVLHLLGSSSFKNKMVTPQVLRQLANLTKLVEASFQGRDDFRVTLLQVLECITGDAPLVTQNGEIIIREILPSLAAIYNGNKDGDARFLCLKIWFDSLTILLTECTEIEQQISEDLKSISNSHFLPLYPALIQDEDPIPAYAQKLLVMLVEFDYIKISNLLRHNTVSQCFEFLLGDLSSANVNNVKLCLALASAPEMESKLLSQLKVVRRIGNLLEFVNAKDMEDFLEPTLSLCRAFLLRSLGNKKGLSSNYTKEPTLLSEASFTFEVDPQECIRDIADFGSNIGLFLHFAGLDDDTSIAVADIASECVVLLLKAASREATTGFLTNLPKITPILDSWRRRKSTELHLLVLKRVLHCLGYACKQYLSQAMILSISGHDVSKINAIVSEMKNSDAAGLNSIASLVAMELQRLPR

superfamily: SSF56112
IPR011009
2-284 Kinase_like
Protein kinase-like domain

NQYHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFWKSKINLVQLPTQPAFDDMIGINTKPCLSERN

HMMPfam: PF00069
IPR017442
4-252 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAF

ProfileScan: PS50011
IPR000719
4-253 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFW

HMMSmart: SM00220
IPR002290
4-253 S_TKc
Serine/threonine-protein kinase domain

YHIYEAIGHGKCSTVYKGRKKKTIEYFACKSVDKSRKNKVLQEVRILHSLNHPNVLKFYAWYETSAHMWLVLEYCVGGDLRTLLQQDCKLPEESIYGLAYDLVIALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFW

Gene3D: G3DSA:1.10.510.10
107-256 G3DSA:1.10.510.10

IALQYLHSKGIIYCDLKPSNILLDENGHIKLCDFGLSRKLDDISKSPSTGKRGTPYYMAPELYEDGGIHSFASDLWALGCVLYECYTGRPPFVAREFTQLVKSIHSDPTPPLPGNASRSFVNLIESLLIKDPAQRIQWADLCGHAFWKSK

PatternScan: PS00108
IPR008271
117-129 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYCDLKPSNILL

superfamily: SSF48371
IPR016024
550-908 ARM-type_fold,NBS
Armadillo-type fold

GKQELEPLNNRIITVLSGSSSGLSEKQNLIRYLETLSTNADAANILTNGPIMLVLVKVLRLSKTPAFRVQIASLIGLLIRHSTSIEDDLANSGILDSLTNGLRDKHEKVRRFSMAALGELLFYISTQNEHKDFKPPESPSKETRSASGWQVSNALISLVSSVLRKGEDDLTQVYALRTIENICSQGAYWATRFSSQDLISNLCYIYKATGKQESMRQTAGSCLVRLARFNPPCIQTVVEKLSLKEIASSFVKGSAREQQVCLNLLNMAMIGSHTFTSFGRHLVTLTEEKNLFPSLLSIIEQGTEVLRGKALLFVAFLCKNSRRWLTNFFCNARFLPVVDRLAKEKDSYLQQCLEAFVNV

Gene3D: G3DSA:1.25.10.10
IPR011989
560-672 ARM-like
Armadillo-like helical

RIITVLSGSSSGLSEKQNLIRYLETLSTNADAANILTNGPIMLVLVKVLRLSKTPAFRVQIASLIGLLIRHSTSIEDDLANSGILDSLTNGLRDKHEKVRRFSMAALGELLFY

Gene3D: G3DSA:1.25.10.10
IPR011989
704-962 ARM-like
Armadillo-like helical

LISLVSSVLRKGEDDLTQVYALRTIENICSQGAYWATRFSSQDLISNLCYIYKATGKQESMRQTAGSCLVRLARFNPPCIQTVVEKLSLKEIASSFVKGSAREQQVCLNLLNMAMIGSHTFTSFGRHLVTLTEEKNLFPSLLSIIEQGTEVLRGKALLFVAFLCKNSRRWLTNFFCNARFLPVVDRLAKEKDSYLQQCLEAFVNVIASIIPGMLDTITNDIQQLMTGRRHGPVSPLNSRAPVKTNAHLFPVVLHLLGSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox