PRGDB00066670 (At.51233)

From PRG Wiki
Jump to: navigation, search
At.51233
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79472726 (NM_117388)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ATP binding

DNA Sequence

ATGAGTTGTTTCTTGGGTCCATCGACAAACAACAAAAGTAGGGAGAATGAAGGCTCATCTATGGCTGCTCCTTATGAACAACAAAACCTACCACGGAATGATCGTAGGCAGATAACAACATGGGAAGCGGTGGGAACGAACAAAGAATCACCGAAAAATATCAAGGCAAAGAGTTTCAAATTTCGTGAATTAGCAACCGCTACAAATAGTTTCAGGCAAGAGTTCTTGATCGGAGAAGGAGGGTTTGGGAGGGTTTACAAAGGAAAGATGGAGAAGACAGGACAGGTGGTAGCTGTGAAGCAACTTGACCGTAATGGATTACAAGGGAATAGAGAGTTTCTGGTAGAGATCTTCAGGTTAAGTCTTCTTCATCATCCCAACCTTGCCAATCTCATTGGATATTGCCTTGATGGAGACCAGAGACTTCTTGTTCACGAGTTCATGCCTCTTGGTTCCCTTGAAGATCATCTCCTAGATGTTGTAGTAGGACAACAACCATTGGATTGGAACTCTCGGATAAGGATTGCCTTAGGAGCCGCAAAAGGGCTCGAATATCTCCACGAAAAGGCAAACCCTCCGGTGATATATCGAGATTTCAAATCGTCAAATATATTGCTTAATGTAGATTTTGATGCAAAACTATCAGATTTTGGTTTGGCAAAACTTGGTTCGGTTGGGGACACACAAAATGTATCTTCCCGAGTAGTGGGAACTTATGGTTATTGCGCTCCTGAGTATCACAAAACCGGTCAGCTGACGGTTAAATCTGATGTATATAGTTTTGGGGTTGTGTTGTTGGAACTCATAACCGGTAAGCGAGTTATCGACACAACGAGACCATGTCATGAACAAAATCTGGTTACTTGGGCACAACCGATTTTCAGAGAACCAAATAGATTCCCCGAGCTAGCGGATCCACTTCTTCAAGGGGAGTTCCCGGAAAAAAGTTTGAACCAAGCTGTAGCAATAGCGGCAATGTGTCTACAAGAAGAACCAATAGTTCGACCTTTAATCAGTGATGTTGTCACCGCCTTAAGTTTTATGAGTACAGAAACCGGTTCACCTTCCGGTCTAACGGGAACCGCTCTTAACCCTTTATCTCCTAAGACCGTGGAGGACCAGGGCTGGCTTCAATGTGAGTCTCCAAGAGATGTGTACTCGTTACTATAA


Protein sequences

Name Description Sequence
At.51233 translated coding region predicted by ESTScan from UniGene At.51233

MSCFLGPSTNNKSRENEGSSMAAPYEQQNLPRNDRRQITTWEAVGTNKESPKNIKAKSFKFRELATATNSFRQEFLIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFMPLGSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTALSFMSTETGSPSGLTGTALNPLSPKTVEDQGWLQCESPRDVYSLL

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
41-353 Kinase_like
Protein kinase-like domain

WEAVGTNKESPKNIKAKSFKFRELATATNSFRQEFLIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFMPLGSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTALSFMSTETG

HMMPanther: PTHR24420
47-350 PTHR24420,FAMILY NOT NAMED

NKESPKNIKAKSFKFRELATATNSFRQEFLIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFMPLGSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTALSFMST

HMMPanther: PTHR24420:SF700
47-350 PTHR24420:SF700

NKESPKNIKAKSFKFRELATATNSFRQEFLIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFMPLGSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTALSFMST

Gene3D: G3DSA:3.30.200.20
55-148 G3DSA:3.30.200.20

KAKSFKFRELATATNSFRQEFLIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFM

ProfileScan: PS50011
IPR000719
71-348 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRQEFLIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFMPLGSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTALSFM

HMMPfam: PF00069
IPR017442
76-341 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LIGEGGFGRVYKGKMEKTGQVVAVKQLDRNGLQGNREFLVEIFRLSLLHHPNLANLIGYCLDGDQRLLVHEFMPLGSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDV

PatternScan: PS00107
IPR017441
77-100 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGRVYKGKMEKTGQVVAVK

Gene3D: G3DSA:1.10.510.10
151-348 G3DSA:1.10.510.10

GSLEDHLLDVVVGQQPLDWNSRIRIALGAAKGLEYLHEKANPPVIYRDFKSSNILLNVDFDAKLSDFGLAKLGSVGDTQNVSSRVVGTYGYCAPEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPELADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTALSFM

PatternScan: PS00108
IPR008271
194-206 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox