PRGDB00066677 (At.51475)

From PRG Wiki
Jump to: navigation, search
At.51475
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18379263 (NM_100299)
Gene Class Unknown
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana flavin-containing monooxygenase family protein

DNA Sequence

ATGGAGAATATGTTTAGACTCATGGCAAGTGAAGAATATTTCTCAGAGCGGCGATGTGTTTGGGTCAACGGTCCGGTTATCGTAGGAGCTGGTCCATCCGGTTTAGCTACAGCAGCTTGTCTACATGATCAAGGAGTCCCATTCGTTGTGGTCGAGAGATCAGATTGCATAGCGTCACTGTGGCAAAAACGAACCTACGATAGGCTCAAGCTTCACTTGCCCAAGAAATTCTGCCAATTACCGAAAATGCCCTTCCCGGATCACTACCCTGAATACCCAACGAAACGACAGTTCATCGATTACCTTGAGTCATACGCAAACCGGTTCGATATTAAACCGGAGTTTAATAAAAGCGTTGAGTCTGCTCGGTTTGATGAAACTAGCGGGCTATGGAGGGTTAGAACAACCTCAGACGGAGAGGAGATGGAATATATTTGCCGGTGGTTGGTGGTGGCGACGGGAGAAAACGCCGAACGTGTTGTCCCAGAGATTAATGGTCTTATGACGGAGTTTGACGGAGAAGTGATTCACGCTTGTGAGTATAAGTCCGGCGAGAAATTCAGAGGAAAGAGAGTTCTTGTCGTCGGATGTGGAAACTCAGGCATGGAAGTCTCTCTTGATCTTGCTAACCACAATGCAATTACTTCCATGGTCGTTAGAAGCTCGGTTCATGTTTTACCGAGGGAGATTATGGGGAAATCAACATTTGGAATCTCAGTGATGATGATGAAGTGGCTACCTTTATGGCTCGTAGACAAGCTTCTGCTTATCTTATCGTGGTTGGTTCTAGGGAGCTTATCAAACTATGGGCTTAAAAGGCCTGACATCGGCCCAATGGAGCTTAAAAGCATGACAGGAAAGACGCCGGTTCTTGACATCGGTGCTCTGGAGAAGATAAAATCCGGCGACGTAGAAATTGTACCTGCAATCAAACAGTTCTCGCGTCACCACGTGGAGCTCGTAGATGGTCAGAAGCTAGATATCGACGCTGTGGTTCTCGCCACCGGTTATCGTAGCAACGTCCCTTCTTGGCTTCAGGAAAGTGAGTTCTTTTCGAAAAATGGGTTTCCGAAATCGCCGTTTCCAAACGCGTGGAAAGGGAAATCGGGATTATACGCGGCCGGATTCACGAGAAAAGGGTTGGCTGGAGCATCAGTAGACGCCGTTAACATCGCTCAAGACATTGGAAATGTGTGGAGAGAAGAGACCAAACGACAGAAGATGAGAAGAAATGTGGGTCACCGAAGATGCATCTCAGTTGCTTAA


Protein sequences

Name Description Sequence
At.51475 translated coding region predicted by ESTScan from UniGene At.51475

MENMFRLMASEEYFSERRCVWVNGPVIVGAGPSGLATAACLHDQGVPFVVVERSDCIASLWQKRTYDRLKLHLPKKFCQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFNKSVESARFDETSGLWRVRTTSDGEEMEYICRWLVVATGENAERVVPEINGLMTEFDGEVIHACEYKSGEKFRGKRVLVVGCGNSGMEVSLDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIVPAIKQFSRHHVELVDGQKLDIDAVVLATGYRSNVPSWLQESEFFSKNGFPKSPFPNAWKGKSGLYAAGFTRKGLAGASVDAVNIAQDIGNVWREETKRQKREEMWVTEDASQLLX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
1-411 MONOOXYGENASE,MONOOXYGENASE

MENMFRLMASEEYFSERRCVWVNGPVIVGAGPSGLATAACLHDQGVPFVVVERSDCIASLWQKRTYDRLKLHLPKKFCQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFNKSVESARFDETSGLWRVRTTSDGEEMEYICRWLVVATGENAERVVPEINGLMTEFDGEVIHACEYKSGEKFRGKRVLVVGCGNSGMEVSLDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIVPAIKQFSRHHVELVDGQKLDIDAVVLATGYRSNVPSWLQESEFFSKNGFPKSPFPNAWKGKSGLYAAGFTRKGLAGASVDAVNIAQDIGNVWREETKRQKREEM

HMMPanther: PTHR23023
1-411 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

MENMFRLMASEEYFSERRCVWVNGPVIVGAGPSGLATAACLHDQGVPFVVVERSDCIASLWQKRTYDRLKLHLPKKFCQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFNKSVESARFDETSGLWRVRTTSDGEEMEYICRWLVVATGENAERVVPEINGLMTEFDGEVIHACEYKSGEKFRGKRVLVVGCGNSGMEVSLDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIVPAIKQFSRHHVELVDGQKLDIDAVVLATGYRSNVPSWLQESEFFSKNGFPKSPFPNAWKGKSGLYAAGFTRKGLAGASVDAVNIAQDIGNVWREETKRQKREEM

FPrintScan: PR00469
IPR000103
24-46 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPVIVGAGPSGLATAACLHDQGV

FPrintScan: PR00368
IPR013027
25-44 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PVIVGAGPSGLATAACLHDQ

superfamily: SSF51905
26-307 FAD/NAD(P)-binding domain

VIVGAGPSGLATAACLHDQGVPFVVVERSDCIASLWQKRTYDRLKLHLPKKFCQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFNKSVESARFDETSGLWRVRTTSDGEEMEYICRWLVVATGENAERVVPEINGLMTEFDGEVIHACEYKSGEKFRGKRVLVVGCGNSGMEVSLDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIV

Gene3D: G3DSA:3.50.50.60
26-205 no description

VIVGAGPSGLATAACLHDQGVPFVVVERSDCIASLWQKRTYDRLKLHLPKKFCQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFNKSVESARFDETSGLWRVRTTSDGEEMEYICRWLVVATGENAERVVPEINGLMTEFDGEVIHACEYKSGEKFRGKRVLVVGCGNSGMEVS

HMMPfam: PF00743
IPR020946
27-348 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLATAACLHDQGVPFVVVERSDCIASLWQKRTYDRLKLHLPKKFCQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFNKSVESARFDETSGLWRVRTTSDGEEMEYICRWLVVATGENAERVVPEINGLMTEFDGEVIHACEYKSGEKFRGKRVLVVGCGNSGMEVSLDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIVPAIKQFSRHHVELVDGQKLDIDAVVLATGYRSNVPSWLQES

FPrintScan: PR00368
IPR013027
146-164 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

CRWLVVATGENAERVVPEI

superfamily: SSF51905
174-400 FAD/NAD(P)-binding domain

EVIHACEYKSGEKFRGKRVLVVGCGNSGMEVSLDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIVPAIKQFSRHHVELVDGQKLDIDAVVLATGYRSNVPSWLQESEFFSKNGFPKSPFPNAWKGKSGLYAAGFTRKGLAGASVDAVNIAQDIGNVWR

FPrintScan: PR00469
IPR000103
187-211 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FRGKRVLVVGCGNSGMEVSLDLANH

FPrintScan: PR00368
IPR013027
191-209 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEVSLDLA

Gene3D: G3DSA:3.50.50.60
206-398 no description

LDLANHNAITSMVVRSSVHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTGKTPVLDIGALEKIKSGDVEIVPAIKQFSRHHVELVDGQKLDIDAVVLATGYRSNVPSWLQESEFFSKNGFPKSPFPNAWKGKSGLYAAGFTRKGLAGASVDAVNIAQDIGNV

Seg: seg
245-267 seg

WLPLWLVDKLLLILSWLVLGSLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox