PRGDB00066712 (At.52084)

From PRG Wiki
Jump to: navigation, search
At.52084
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18402416 (NM_103784)
Gene Class Unknown
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana YUC10; FAD binding

DNA Sequence

ATGGAGACCGTAGTGGTGATTGTGGGAGCTGGACCGGCCGGTTTAGCAACATCGGTTTGTCTAAACCAACACTCAATCCCAAACGTGATCCTCGAGAAAGAAGACATCTATGCATCCCTTTGGAAGAAACGAGCGTACGATCGTCTCAAACTTCACTTAGCCAAAGAATTTTGCCAGCTTCCTTTCATGCCACACGGTCGTGAGGTTCCAACCTTTATGTCCAAAGAGCTTTTCGTCAACTACCTTGACGCTTACGTTGCCCGTTTCGACATCAACCCTAGGTACAACCGTACCGTGAAGTCCTCAACGTTCGATGAGTCCAATAACAAGTGGAGGGTCGTGGCCGAAAACACGGTAACCGGAGAAACCGAGGTGTATTGGTCGGAGTTTCTGGTGGTTGCGACCGGGGAGAACGGAGATGGGAATATTCCGATGGTGGAGGGGATTGACACTTTTGGGGGAGAGATTATGCACTCGAGTGAGTACAAGTCCGGTCGTGATTTTAAAGATAAAAATGTTCTTGTGGTCGGAGGTGGAAATTCCGGTATGGAGATTAGTTTTGATCTTTGCAACTTCGGAGCTAATACGACCATTCTAATTAGAACTCCAAGACACGTGGTGACTAAAGAAGTGATACACTTGGGGATGACACTTCTGAAGTATGCTCCAGTGGCGATGGTCGACACATTGGTGACGACTATGGCAAAAATTTTGTACGGAGATCTCTCCAAGTACGGACTCTTCCGACCAAAACAAGGTCCTTTCGCCACCAAACTCTTTACCGGAAAAGCTCCTGTCATTGATGTTGGAACTGTCGAGAAGATTCGCGATGGCGAGATTCAGGTTATCAATGGTGGGATTGGAAGCATCAACGGGAAGACCTTGACGTTCGAAAACGGACATAAACAAGATTTCGATGCGATTGTGTTTGCTACTGGTTACAAAAGCTCCGTTTGCAATTGGTTAGAGGACTATGAATACGTGATGAAGAAGGATGGATTCCCCAAAGCACCGATGCCAAAACATTGGAAAGGAGAGAAGAATCTTTACTGTGCCGGATTTTCAAGAAAAGGAATCGCCGGAGGTGCTGAGGATGCTATGTCTGTAGCCGACGACATCAGATCTATCTTGGCTACCTTAAAAAATAATTGA


Protein sequences

Name Description Sequence
At.52084 translated coding region predicted by ESTScan from UniGene At.52084

METVVVIVGAGPAGLATSVCLNQHSIPNVILEKEDIYASLWKKRAYDRLKLHLAKEFCQLPFMPHGREVPTFMSKELFVNYLDAYVARFDINPRYNRTVKSSTFDESNNKWRVVAENTVTGETEVYWSEFLVVATGENGDGNIPMVEGIDTFGGEIMHSSEYKSGRDFKDKNVLVVGGGNSGMEISFDLCNFGANTTILIRTPRHVVTKEVIHLGMTLLKYAPVAMVDTLVTTMAKILYGDLSKYGLFRPKQGPFATKLFTGKAPVIDVGTVEKIRDGEIQVINGGIGSINGKTLTFENGHKQDFDAIVFATGYKSSVCNWLEDYEYVMKKDGFPKAPMPKHWKGEKNLYCAGFSRKGIAGGAEDAMSVADDIRSILATLKNN

Domains

Domain Start-End Description Sequence

FPrintScan: PR00469
IPR000103
4-26 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

VVVIVGAGPAGLATSVCLNQHSI

Gene3D: G3DSA:3.50.50.60
5-205 G3DSA:3.50.50.60

VVIVGAGPAGLATSVCLNQHSIPNVILEKEDIYASLWKKRAYDRLKLHLAKEFCQLPFMPHGREVPTFMSKELFVNYLDAYVARFDINPRYNRTVKSSTFDESNNKWRVVAENTVTGETEVYWSEFLVVATGENGDGNIPMVEGIDTFGGEIMHSSEYKSGRDFKDKNVLVVGGGNSGMEISFDLCNFGANTTILIRTPRH

HMMPfam: PF00743
IPR020946
5-318 FMO-like
Flavin-containing monooxygenase-like

VVIVGAGPAGLATSVCLNQHSIPNVILEKEDIYASLWKKRAYDRLKLHLAKEFCQLPFMPHGREVPTFMSKELFVNYLDAYVARFDINPRYNRTVKSSTFDESNNKWRVVAENTVTGETEVYWSEFLVVATGENGDGNIPMVEGIDTFGGEIMHSSEYKSGRDFKDKNVLVVGGGNSGMEISFDLCNFGANTTILIRTPRHVVTKEVIHLGMTLLKYAPVAMVDTLVTTMAKILYGDLSKYGLFRPKQGPFATKLFTGKAPVIDVGTVEKIRDGEIQVINGGIGSINGKTLTFENGHKQDFDAIVFATGYKSSV

superfamily: SSF51905
5-283 SSF51905

VVIVGAGPAGLATSVCLNQHSIPNVILEKEDIYASLWKKRAYDRLKLHLAKEFCQLPFMPHGREVPTFMSKELFVNYLDAYVARFDINPRYNRTVKSSTFDESNNKWRVVAENTVTGETEVYWSEFLVVATGENGDGNIPMVEGIDTFGGEIMHSSEYKSGRDFKDKNVLVVGGGNSGMEISFDLCNFGANTTILIRTPRHVVTKEVIHLGMTLLKYAPVAMVDTLVTTMAKILYGDLSKYGLFRPKQGPFATKLFTGKAPVIDVGTVEKIRDGEIQVI

HMMPanther: PTHR23023
5-377 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

VVIVGAGPAGLATSVCLNQHSIPNVILEKEDIYASLWKKRAYDRLKLHLAKEFCQLPFMPHGREVPTFMSKELFVNYLDAYVARFDINPRYNRTVKSSTFDESNNKWRVVAENTVTGETEVYWSEFLVVATGENGDGNIPMVEGIDTFGGEIMHSSEYKSGRDFKDKNVLVVGGGNSGMEISFDLCNFGANTTILIRTPRHVVTKEVIHLGMTLLKYAPVAMVDTLVTTMAKILYGDLSKYGLFRPKQGPFATKLFTGKAPVIDVGTVEKIRDGEIQVINGGIGSINGKTLTFENGHKQDFDAIVFATGYKSSVCNWLEDYEYVMKKDGFPKAPMPKHWKGEKNLYCAGFSRKGIAGGAEDAMSVADDIRSIL

HMMPanther: PTHR23023:SF5
5-377 PTHR23023:SF5,MONOOXYGENASE

VVIVGAGPAGLATSVCLNQHSIPNVILEKEDIYASLWKKRAYDRLKLHLAKEFCQLPFMPHGREVPTFMSKELFVNYLDAYVARFDINPRYNRTVKSSTFDESNNKWRVVAENTVTGETEVYWSEFLVVATGENGDGNIPMVEGIDTFGGEIMHSSEYKSGRDFKDKNVLVVGGGNSGMEISFDLCNFGANTTILIRTPRHVVTKEVIHLGMTLLKYAPVAMVDTLVTTMAKILYGDLSKYGLFRPKQGPFATKLFTGKAPVIDVGTVEKIRDGEIQVINGGIGSINGKTLTFENGHKQDFDAIVFATGYKSSVCNWLEDYEYVMKKDGFPKAPMPKHWKGEKNLYCAGFSRKGIAGGAEDAMSVADDIRSIL

FPrintScan: PR00368
IPR013027
5-24 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

VVIVGAGPAGLATSVCLNQH

FPrintScan: PR00469
IPR000103
168-192 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FKDKNVLVVGGGNSGMEISFDLCNF

FPrintScan: PR00368
IPR013027
172-190 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

NVLVVGGGNSGMEISFDLC

Gene3D: G3DSA:3.50.50.60
269-375 G3DSA:3.50.50.60

VGTVEKIRDGEIQVINGGIGSINGKTLTFENGHKQDFDAIVFATGYKSSVCNWLEDYEYVMKKDGFPKAPMPKHWKGEKNLYCAGFSRKGIAGGAEDAMSVADDIRS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox