PRGDB00066754 (At.52558)

From PRG Wiki
Jump to: navigation, search
At.52558
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337712 (NM_106500)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT1G78530) mRNA, complete cds

DNA Sequence

CAAAAGTTTACAAGTTTTCAGAAAAACAATGGCTAATGCAAAGGAAACAACGTTTTATATAACAATCTCTGTGGTTGCTTTTGTCATTGGCAAAATCGTAATCGCTCTTCTTTTCTACAAGAGATGGAAGAGAAAGCACACAATTCATGAAAATGGATTTCCAGTCAAAGGAGGAGGAAAAATGGTGATGTTTAGATCTCAATTACTTAACTCTGTTTCCTCCGACATGTTTATGAAGAAGACACATAAACTAAGCAACAAAGACATTCTTGGTTCTGGAGGATTTGGAACTGTGTACAGATTAGTCATTGATGATTCAACTACTTTTGCTGTGAAGAGGCTAAACAGAGGAACTTCTGAGAGAGACAGAGGGTTTCATAGAGAGTTAGAAGCAATGGCTGATATAAAACACAGAAACATTGTAACTCTTCATGGCTACTTTACTTCTCCACATTACAATCTTCTCATCTATGAGCTCATGCCTAATGGGAGCTTGGATTCTTTTCTACACGGAAGAAAAGCTTTGGATTGGGCGTCGAGATATAGAATCGCAGTAGGAGCGGCTAGAGGGATTTCGTACCTTCACCATGATTGCATTCCTCACATTATCCATAGAGACATCAAATCTAGCAACATACTTCTTGATCACAACATGGAAGCTAGGGTTTCTGATTTCGGTTTAGCCACTTTGATGGAGCCAGACAAGACTCATGTTTCGACTTTTGTGGCTGGAACATTCGGATATTTAGCTCCTGAGTATTTCGATACTGGAAAAGCGACAATGAAAGGAGATGTTTACAGTTTCGGAGTTGTTCTGTTGGAGCTTTTAACTGGAAGAAAACCAACAGATGACGAGTTTTTCGAAGAAGGAACAAAGCTTGTTACTTGGGTTAAAGGAGTGGTAAGAGACCAAAGAGAAGAGGTGGTGATAGATAACCGATTAAGAGGATCATCGGTTCAAGAGAATGAAGAGATGAACGATGTGTTTGGTATAGCGATGATGTGTCTTGAACCCGAACCAGCAATTAGACCAGCCATGACTGAGGTTGTCAAATTGCTCGAATACATCAAACTTTCCACACGTTCCTCTTTTTGATGTTTCTCTTGTCAAGAAAAATAATCAAATTCAGTTCCAAAATAAAGTTTTGCTGAAGAAAAAGATTTCGAGATCTGCTTCTTTGAAAAGCTAAATTGTAATTTAATACTCCATATTAGTATAGTAAAGATTATTTATAATTGATTTGTTTTAGTATGGAATAAAGGATTATTACACACAAAAAA


Protein sequences

Name Description Sequence
At.52558 translated coding region predicted by ESTScan from UniGene At.52558

MANAKETTFYITISVVAFVIGKIVIALLFYKRWKRKHTIHENGFPVKGGGKMVMFRSQLLNSVSSDMFMKKTHKLSNKDILGSGGFGTVYRLVIDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMPNGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLEYIKLSTRSSF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF424
8-348 PTHR24420:SF424,SUBFAMILY NOT NAMED

TFYITISVVAFVIGKIVIALLFYKRWKRKHTIHENGFPVKGGGKMVMFRSQLLNSVSSDMFMKKTHKLSNKDILGSGGFGTVYRLVIDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMPNGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLEYIK

HMMPanther: PTHR24420
8-348 PTHR24420,FAMILY NOT NAMED

TFYITISVVAFVIGKIVIALLFYKRWKRKHTIHENGFPVKGGGKMVMFRSQLLNSVSSDMFMKKTHKLSNKDILGSGGFGTVYRLVIDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMPNGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLEYIK

Gene3D: G3DSA:2.60.120.200
IPR013320
12-93 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

TISVVAFVIGKIVIALLFYKRWKRKHTIHENGFPVKGGGKMVMFRSQLLNSVSSDMFMKKTHKLSNKDILGSGGFGTVYRLV

superfamily: SSF56112
IPR011009
45-352 Kinase_like
Protein kinase-like domain

PVKGGGKMVMFRSQLLNSVSSDMFMKKTHKLSNKDILGSGGFGTVYRLVIDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMPNGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLEYIKLSTR

ProfileScan: PS50011
IPR000719
75-347 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LSNKDILGSGGFGTVYRLVIDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMPNGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLEYI

HMMPfam: PF00069
IPR017442
78-342 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KDILGSGGFGTVYRLVIDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMPNGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVK

PatternScan: PS00107
IPR017441
81-103 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGGFGTVYRLVIDDSTTFAVK

Gene3D: G3DSA:3.30.200.20
94-152 G3DSA:3.30.200.20

IDDSTTFAVKRLNRGTSERDRGFHRELEAMADIKHRNIVTLHGYFTSPHYNLLIYELMP

Gene3D: G3DSA:1.10.510.10
153-346 G3DSA:1.10.510.10

NGSLDSFLHGRKALDWASRYRIAVGAARGISYLHHDCIPHIIHRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGTFGYLAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEVVIDNRLRGSSVQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLEY

PatternScan: PS00108
IPR008271
193-205 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox