PRGDB00066797 (At.53472)

From PRG Wiki
Jump to: navigation, search
At.53472
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 91806468 (DQ446692)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone pENTR221-At3g24540 protein kinase family protein (At3g24540) mRNA, complete cds

DNA Sequence

ATGGCGCGTAGTAATAGATGTGTACCCCAAAATAGTTCCATTGTCCAAATTCCGATAGAAGAAGTATTCAAAACTCAACTCAAGTCTCGGTGGCAGCAGATCACAATGTCATCTGCTTCTTCTCCACCGCCGCCGCAGGTTTTCGTCCCAGAGCCACTTTTTTCCGAACCCCCGCCTCCTCCCAAAGCACCCGTTAACGTTTCCCTATCTCCACCGCCTCCTCCGCGGTCTCCCTCCACATCCACTCCACCTAGGTTGGGAAATCGAAACCCTCCACCTCCAGCGAGTCCCTCTGGCCAGGAACCTACAACTCCAACTATGACCCCAGGCTTTTCTCTATCACCGCCGTCTCCCTCAAGATTATCAACGGGAGCTGTGGTCGGGATCTCCATAGGAGGAGGAGtttttgtgttgactttgatttttttcctttgTAAGAAGAAACGACCAAGAGACGATAAAGCACTTCCGGCTCCCATAGGGCTTGTATTAGGCATCCATCAAAGCACTTTCACTTACGGGGAGCTAGCTAGAGCCACCAATAAATTCTCTGAGGCCAATTTGTTAGGAGAGGGTGGATTTGGATTCGTATACAAAGGTATATTGAATAATGGAAATGAAGTTGCAGTTAAACAGTTGAAAGTAGGGAGTGCTCAGGGTGAGAAAGAGTTTCAGGCTGAGGTTAATATTATTAGCCAAATTCACCATAGGAATTTGGTTTCCCTTGTCGGTTATTGCATCGCTGGTGCTCAAAGATTGCTTGTCTATGAGTTTGTTCCCAACAACACTCTCGAGTTTCACCTCCATGGGAAAGGACGGCCTACGATGGAATGGAGTTTAAGATTAAAGATTGCTGTCAGTTCTTCCAAAGGATTGTCTTATCTTCATGAAAATTGCAATCCTAAAATCATCCACCGTGATATCAAGGCGGCAAACATATTGATTGATTTCAAATTTGAAGCAAAGGTACGATTTATCTTTCTTTCTTTTTTAAGTTTCCATTAAGACATTGTGATTATATGTAACTTGGTACGATTATTTTCGTCAGGAAACCTTTGTGTTTTGTGTCTTTATTCTATCTTTTAGGTTGCTGATTTTGGTCTCGCCAAGATTGCTTTGGATACAAACACTCATGTATCTACACGTGTTATGGGAACCTTTGGGTATTTGGCTCCGGAATATGCTGCAAGTGGAAAGCTTACTGAAAAGTCTGATGTTTACTCATTCGGCGTTGTACTTTTGGAGCTAATAACGGGACGTCGCCCTGTTGATGCAAACAATGTCTATGCGGATGACAGCTTGGTTGATTGGGCACGACCATTGCTTGTACAAGCACTTGAAGAAAGTAACTTTGAAGGTTTGGCTGATATAAAGCTGAATAATGAGTATGATAGAGAAGAGATGGCTCGCATGGTTGCTTGTGCTGCAGCTTGTGTCCGCTATACAGCTCGCCGAAGACCTCGCATGGACCAGGTTGTGCGTGTGCTAGAAGGAAACATATCGCCGTCAGATCTGAATCAAGGGATAACACCCGGTCACAGCAATGTATACAGTTCATAGAGGAAGCACATATTATGATACGAGAACAATGTAGACGTACACGAGGAAGTTTCGGATAAAAATGGGGCACGGTGGGCGAGTACAGTAATCCAACTAGTGACTATAGACTGTATCCGTCCGGCTGGACGCTCGAGCAGTGAGGGTCAAGCCACACGGGGAAATGGATTCGAGATGGGGAAGATTTAAAAGAACTGCTCAACGTTATGGTGGAGATTCTCTTTAA


Protein sequences

Name Description Sequence
At.53472 translated coding region predicted by ESTScan from UniGene At.53472

MARSNRCVPQNSSIVQIPIEEVFKTQLKSRWQQITMSSASSPPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPSPSRLSTGAVVGISIGGGVFVLTLIFFLCKKKRPRDDKALPAPIGLVLGIHQSTFTYGELARATNKFSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNISPSDLNQGITPGHSNVYSSXRKHILXYENNVDVHEEVSDKNGARWASTVIQLVTIDCIRPAGRSSSEGQATRGNGFEMGKI

Domains

Domain Start-End Description Sequence

Seg: seg
37-45 seg

SSASSPPPP

HMMPanther: PTHR24420:SF822
40-564 SUBFAMILY NOT NAMED

SSPPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPSPSRLSTGAVVGISIGGGVFVLTLIFFLCKKKRPRDDKALPAPIGLVLGIHQSTFTYGELARATNKFSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNISPSDLNQGITPGHSNVYSSXRKHILXYENNVDVHEEVSDKNGARWASTVIQLVTIDCIRPAGRS

HMMPanther: PTHR24420
40-564 FAMILY NOT NAMED,FAMILY NOT NAMED

SSPPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPSPSRLSTGAVVGISIGGGVFVLTLIFFLCKKKRPRDDKALPAPIGLVLGIHQSTFTYGELARATNKFSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNISPSDLNQGITPGHSNVYSSXRKHILXYENNVDVHEEVSDKNGARWASTVIQLVTIDCIRPAGRS

Seg: seg
47-98 seg

VFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPS

Seg: seg
112-122 seg

SLSPPSPSRLS

Seg: seg
124-137 seg

GAVVGISIGGGVFV

Gene3D: G3DSA:3.30.200.20
169-244 no description

STFTYGELARATNKFSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVG

superfamily: SSF56112
IPR011009
169-521 Protein kinase-like (PK-like)
Protein kinase-like domain

STFTYGELARATNKFSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNISPSDLNQGITPGHSNVYSSXR

ProfileScan: PS50011
IPR000719
183-500 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNI

HMMSmart: SM00219
IPR020635
183-496 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVL

HMMSmart: SM00220
IPR002290
183-496 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVL

HMMPfam: PF00069
IPR017442
187-435 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVRFIFLSFLSFHXDIVIICNLVRLFSSGNLCVLCLYSIFXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLV

PatternScan: PS00107
IPR017441
189-211 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGFVYKGILNNGNEVAVK

PatternScan: PS00108
IPR008271
303-315 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKAANILI

Gene3D: G3DSA:1.10.510.10
361-494 no description

FXVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVR

Seg: seg
465-479 seg

REEMARMVACAAACV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox