PRGDB00066845 (At.54509)

From PRG Wiki
Jump to: navigation, search
At.54509
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145343915 (NM_118633)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana nodulin MtN3 family protein (AT4G25010) mRNA, complete cds

DNA Sequence

ATGTCTCTATATATAGTGAACCATTGGCCTCGCTAGTTAATTCATATCGAAGAAAACTCAAATAGAGGAATCAAGAGTCGAAGATCTCTATATATTTTCCCTTCTCTTGTTTCCTTATTAGTTTTCTCCGACACTCCCATTCAAAAGTAGAAAGATACTGAAGAGCTCGCTCATTCACAAAATAACCAAAATGGTTCTCACTCACAACGTATTGGCAGTTACATTTGGAGTCCTGGGTAACATCATATCGTTCATCGTTTTCTTGGCACCAGTGCCAACTTTTGTAAGAATCTGCAAGAAAAAATCGATAGAAGGTTTTGAATCACTTCCCTACGTGTCAGCCCTCTTTAGCGCGATGCTATGGATTTACTATGCTCTGCAAAAAGATGGAGCAGGCTTCCTTCTCATTACCATAAACGCTGTGGGATGCTTCATCGAAACCATCTACATCATCCTCTTCATCACCTATGCTAACAAGAAAGCTAGAATATCAACTTTGAAGGTTCTTGGGCTCTTGAATTTCTTGGGTTTTGCTGCTATTATTCTCGTCTGCGAGCTCCTAACCAAAGGATCGAACCGTGAGAAAGTCCTTGGAGGGATTTGCGTCGGATTTTCTGTTTGTGTTTTCGCAGCTCCTTTGAGCATCATGAGAGTGGTGATACGAACAAAGAGTGTGGAGTTTATGCCTTTCTCTCTATCATTGTTTCTTACAATCAGCGCCATTACGTGGCTCTTCTACGGTCTTGCTATTAAAGACTTCTACGTTGCGCTTCCAAATATATTGGGTGCGTTTCTCGGAGCAGTCCAAATGATTCTATACGTCATATTCAAGTACTACAAAACTCCACTAGTGGTTGATGAGACAGAGAAGCCCAAAACGGTGTCGGATCATTCCATCAACATGGTCAAGCTTTCATCTACTCCGGCTTCTGGTGATCTTACGGTTCAGCCGCAGACTAATCCTGACGTGAGTCATCCTATTAAAACTCATGGTGGTGACTTAGAGGACCAGATGGACAAGAAAATGCCAAACTAAGTCAAGATTTAGTTTTCAATTATGAATTAGTGATTGACTTTAATGTTGAACTGTTGAGTCTGGTTTCCTAATTTGTCTTTTATTTTCTCATCATCTTCTTTCGAAATATCTCGAAATTGTACTATCCTTCAAAAATTTATGTGCGTCGTTTAGAATTTTGTAAAATAGTTTTTGATGCCTCTGTTCTCAGTAATACTTAAAAGTTTATTAGTCCGGCTAATTAAAAAGGAAATGAAAATTCAAAG


Protein sequences

Name Description Sequence
At.54509 translated coding region predicted by ESTScan from UniGene At.54509

MVLTHNVLAVTFGVLGNIISFIVFLAPVPTFVRICKKKSIEGFESLPYVSALFSAMLWIYYALQKDGAGFLLITINAVGCFIETIYIILFITYANKKARISTLKVLGLLNFLGFAAIILVCELLTKGSNREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTISAITWLFYGLAIKDFYVALPNILGAFLGAVQMILYVIFKYYKTPLVVDETEKPKTVSDHSINMVKLSSTPASGDLTVQPQTNPDVSHPIKTHGGDLEDQMDKKMPN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
4-281 MtN3_slv_TM
RAG1-activating protein-1-related

THNVLAVTFGVLGNIISFIVFLAPVPTFVRICKKKSIEGFESLPYVSALFSAMLWIYYALQKDGAGFLLITINAVGCFIETIYIILFITYANKKARISTLKVLGLLNFLGFAAIILVCELLTKGSNREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTISAITWLFYGLAIKDFYVALPNILGAFLGAVQMILYVIFKYYKTPLVVDETEKPKTVSDHSINMVKLSSTPASGDLTVQPQTNPDVSHPIKTHGGDLEDQMDKKMPN

HMMPfam: PF03083
IPR004316
11-98 MtN3_slv
RAG1-activating protein-1-related

TFGVLGNIISFIVFLAPVPTFVRICKKKSIEGFESLPYVSALFSAMLWIYYALQKDGAGFLLITINAVGCFIETIYIILFITYANKKA

HMMPfam: PF03083
IPR004316
133-217 MtN3_slv
RAG1-activating protein-1-related

VLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTISAITWLFYGLAIKDFYVALPNILGAFLGAVQMILYVIFKYYK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox