PRGDB00066922 (At.63750)

From PRG Wiki
Jump to: navigation, search
At.63750
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145353480 (NM_119708)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana dihydroflavonol 4-reductase family

DNA Sequence

ACCGGAAAATGGATCAAGCAAAGGGAAAAGTCTGTGTTACTGGTGCTTCAGGCTTCTTGGCTTCTTGGCTTGTAAAGAGGCTTCTACTTGAAGGATATGAAGTTATCGGAACAGTCAGAGATCCAGGAAATGAGAAGAAACTTGCGCACCTATGGAAGTTGGAAGGGGCAAAGGAGAGACTACGGTTGGTGAAGGCTGATTTAATGGAAGAAGGAAGTTTTGATAACGCCATAATGGGATGCCAAGGAGTGTTCCATACTGCTTCTCCGGTGCTTAAACCTACCTCTAATCCAGAGGAGGAGATTCTGAGACCAGCTATAGAAGGAACCCTGAATGTACTGCGATCATGCAGGAAGAATCCTTCCCTGAAGCGCGTGGTTCTCACCTCATCCTCTTCAACAGTCAGGATCAGAGATGATTTTGATCCCAAAATCCCTCTTGACGAATCAATTTGGACGTCTGTGGAACTCTGCAAGCGCTTCCAGGTCTGGTATGCCTTATCAAAGACATTAGCGGAACAAGCTGCATGGAAATTCTCTGAAGAAAATGGTATTGACCTCGTCACTGTTCTACCATCCTTCCTCGTTGGACCCAGTCTGCCTCCTGATTTATGTTCTACAGCTTCCGATGTCCTCGGATTACTGAAAGGAGAAACAGAGAAGTTCCAATGGCATGGACAAATGGGGTATGTTCATATCGATGACGTTGCACGAACCCACATAGTCGTTTTCGAACACGAAGCAGCTCAAGGCAGATACATTTGTAGCTCTAACGTTATCAGTCTAGAGGAACTCGTTTCATTCCTATCTGCTCGTTACCCATCACTCCCTATCCCCAAGAGGTTTGAGAAACTAAATAGGTTGCATTACGACTTTGACACCTCGAAGATACAGAGTCTCGGGCTCAAGTTCAAGTCCCTTGAAGAGATGTTCGATGACTGCATTGCCTCATTAGTCGAGCAAGGCTATTTATCTACTGTTCTTCCATAACTCTTGGACTAGAGAATATGTGCAAATAAGATTGGTCTGAAATAGTAGTCATGTGGATTCACAATGAAAGAATGGGATTGGAAAACATGAAATCAAAGATTACAAACGATATAATCTTTACTTGTTTATGAACCAAATCATAACATATTTCTTCTCTC


Protein sequences

Name Description Sequence
At.63750 translated coding region predicted by ESTScan from UniGene At.63750

XRKMDQAKGKVCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERLRLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTSNPEEEILRPAIEGTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVARTHIVVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEKLNRLHYDFDTSKIQSLGLKFKSLEEMFDDCIASLVEQGYLSTVLP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
2-329 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

RKMDQAKGKVCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERLRLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTSNPEEEILRPAIEGTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVARTHIVVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEKLNRLHYDFDTSKIQSLGLKFKSLEEMFDDCIASLVEQGYLSTVLP

HMMPanther: PTHR10366:SF9
2-329 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

RKMDQAKGKVCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERLRLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTSNPEEEILRPAIEGTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVARTHIVVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEKLNRLHYDFDTSKIQSLGLKFKSLEEMFDDCIASLVEQGYLSTVLP

superfamily: SSF51735
4-320 NAD(P)-binding Rossmann-fold domains

MDQAKGKVCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERLRLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTSNPEEEILRPAIEGTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVARTHIVVFEHEAAQGRYICSSNVISLEELVSFLSARYPSLPIPKRFEKLNRLHYDFDTSKIQSLGLKFKSLEEMFDDCIASLVE

Gene3D: G3DSA:3.40.50.720
IPR016040
10-235 no description
NAD(P)-binding domain

KVCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERLRLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTSNPEEEILRPAIEGTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDD

HMMPfam: PF01370
IPR001509
11-253 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGFLASWLVKRLLLEGYEVIGTVRDPGNEKKLAHLWKLEGAKERLRLVKADLMEEGSFDNAIMGCQGVFHTASPVLKPTSNPEEEILRPAIEGTLNVLRSCRKNPSLKRVVLTSSSSTVRIRDDFDPKIPLDESIWTSVELCKRFQVWYALSKTLAEQAAWKFSEENGIDLVTVLPSFLVGPSLPPDLCSTASDVLGLLKGETEKFQWHGQMGYVHIDDVARTHIVVFEHEAAQGRY

Seg: seg
122-136 seg

SLKRVVLTSSSSTVR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox