PRGDB00067014 (At.69694)

From PRG Wiki
Jump to: navigation, search
At.69694
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145347395 (NM_118978)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein binding

DNA Sequence

CAACAATTGAGTTATTGAAGAATACGTTTGATTGAGAAGCTTCAACGACCGCAATTGCCCAAATTCATCAATTGGAGTTTTTTATAAAACAAATTGCATCTTAAGgttgttattgttgttgttgttTATCTGTCTGTAATCATCTTTCTATCTGCTGTCTGATACATCTACGAATCTTATGCTGTCTTTTGGGTTTTCTTACACAACCAAAACCAAAGCCTAGTTTTGTTTTGACTTCATTTGAAGCAAACCTCTTTCTTTCTTCAGTTATGTGGGTTTTTGAGCTAGACTCGAATCAGTTCTGATCCAGTCGGATTTTGTATTGAGTCATAAAGAAGGGATTTTTGGGGGTTGTGAGTGATATGAAGAAGCGGGAACATTTGGGATTAGGGTTCTTCGAGTGGCAGATTATCTTATGGTTATCGATTTGGTTGGCGATTTCGCAACAAGCGCTGGGATTGAGACCTATTAGGGAGAAACCTCGATCATGGAGTGACGAGTGGCTCTTTGGTAGGAAACAAGAAGCTGAAGTTGGACCCTTTTCTGCTTGGAATATAACAGGAACTTATAGAGGAACTTGGAAGTTTCTGAATTCCTTAAATAGCTCTTCGAAGTTTCAAGACTTTCAAAAAGAAAATGGTAATTCTGTGGTTGAGTTAGTAGCAGTTCCAACGAAGATAACTGGTGTGCATTATGTTCAGGGTGTAGTTGTTTTCCATGACGTATTTGACAATGAACAAAATGTGGGTGGTGCCCAAATAAATCTGGAAGGTGTATATATATGGCCCTTTAGACAACTCCGCCTTGTGGCTAACAGCGGCAAGGAGAGTGATTCAGGGCAAGAAGACAATAATCTTCTCTCAAATCCCTATCATCTGCTTGGAATTTTCTCCTCTCAAGTGTTTCAAGAATCTCCAAGAGACAGATTACTGAAACGGAAACTTTCTCCAGTAAATGAGATGGAGAAGCACTGTAATATCGAAATAGCAGCTCAAGTATCCCGTGTGGCTTCTAGTGAAAATAATGGAGACAAAAATTATTATCACATGGAAGGATTGATGGAAAGTCCTGGGGTAGGCGATGACGGAGATTGTTTTTCCCCTTTGTTACTGAACGCAACTTCTGTAAATGTTGAAGTCTACTATAACAAAGCTGTGAACTATACACTGATGGTCACTTTTGTCTCTTTCCTCCAGGTTCTTCTGTTGATCCGGCAAATGGAGCACGGTAACACACAATCTGGTGCTGCTAAGGTATCCATTGTAATGATTGGGCAACAAGCGATCATGGATGCTTATTTGTGCCTCTTACATCTAACAGCCGGTATATTAGTCGAATCTCTATTTAATGCATTTGCAACCGCTGCGTTCTTCAAGTTCGTAGTCTTTTCGATTTTTGAGATGAGATATCTTCTGGCTATATGGAAAGCAACCCGTCCTTCCAATAGCGGAGAGGGTTGGGAAACAATGAGGAGAGAACTGTCCTTTCTGTACAGTCGTTTCTATGGGATCCTTCTTGGAGGCATTTTGATAATGTACCAGTTCCACAACTACATGCAGCCGATTCTCCTTCTCATGTACTCATTTTGGATACCACAAATAGTCGCCAATGTTGTCCGGGATTCAAGAAAGCCTCTGCACCCATATTACATCTTGGGCATGACAGCTACACGGTTAGCTATACCGTTATATGTTTTTGGATGCCCACACAACTTCATGCGTGTAGAGCCCAACAAGGTTTGGTGTATATGCTTGTGCACATTCATGGGGTTGCAAGCCGTCATTCTTCTTCTTCAGCATTATTTTGGTTCACGCTGCTTTGTTCCCCGTCAGATGCTACCAGAGAAATACAACTACCACCGAAGATTTAATCGGGATGTAAGCCGCACCACTGATTGTGTTATCTGCATGACCGCTATTGATCTCAGACAGCATACCAGTGATTGCATGGTAACTCCATGTGAACATTTCTTTCACTCGGGATGCTTACAGAGATGGATGGATATAAAAATGGAGTGTCCAACTTGTCGGCGGTCTCTTCCTCCAGCATAGAGGATGTTTTCGGTTTGTTAGGATGTACAGACTTCACTCAGATTATTGCGGGTGGGGCTGGTTCTTTAATTTCAGGTCCTTGCAGAGGTTTAGAAGATTTTTAGATGAAAACAGAGCAAAGGTGGAATCTGTAACTGCGGCTAGATACCGCAGATAGACAATTGTGTTCTGTATAAACTGTATTACGTTATAATCTTAGTGCATATTCTTCACCCCACAACTAAATCTTTCACACATTTCTAGTTCTTTCATTTTCTTTGCATACATAGCATCTTGTCATTGTGCGCATAAGAGTGAATCCTTATGTGTCAGCTGGACCAGGAGCAATGGAAGGTCCTGCGGTAGATGGAGCAACCAGTGGAGCCATGGGTGAGCATTCGTGGTCATAGCAGTCTATGGGGTGCTCAAGTACAGCATCACAGACTTTTTGGGGACGCTGAAGCGGTTTGTCAGGCAGACAGTTGTAGCGATCATCGATGGCTATTCCTCTGGAAGTCAGGTTCCTGCAGATACCTTCTTCTTCACTGAAATAGTTGTAAGAGACGGTAACGTTCAGCAAGCTGGGCAAAACGCAGACTCCAAGAGGGACAGTGCCAGTGAACATGTTGTGTTCCAGATTTAGCTGCTCGAGATGGCCTAGCCCAGCGAGACTGTAAGGTACAGGACCAACTAAACTGTTGTAGCTCATGTCCAGGACTCTTAGCTTGTAGAGATACCCGACTTCGGGGGGTAGACACCCAGATAAGCTTGAGTTGATTAGGAGAAGCTCTTCTAAGGTATCTGCAAAGCGGGCTATGGTTGGAGGCAGACAACCGCTAAAATCATTGTTGGCAAAGACGACAACAGAGGCGGTTGTTCCTGTGAAATCTCGGGGGATGAGGCTTGTTAACCGGTTGTTGTTCACAAAAATGGCATCGAGGGGATTGCTGAAGAGTTTTGGAGGCAAGGGGCCTTCAAACTCATTGTAACGAAGGTCAAGGTACTTTAGAGAAGGGAGTGCAAGGACGACATCCGGAAAAGGACCTACAAAGCGGTTGTTGCTGAGGTCAAGTTCATAGAGTAAGGATAGATTGGCAAACGAACGAGGAAGTATGCCACAGAAGCGATTGCTATTGAGATGGATGAGAGCGAGGTCAGAGAGAAGGCCAATGGCTTCAGGCAGGAAACCAGCAATGTCACCATGATTGAGATCGATTCCGGCAACAACTAGAGTGTTTGGATTGGAAGGGGATGGGGCACAGAAGATGCCAGTGTAGCTGCAGACTGAGGGACCGACCCAATCTGCAGTTAAGTTCTTTGGATCAGAATAGATTACCTTCTTCCATGCTTTAAGTGCACGGTACGCTTGCTGAAGATGCTGTTTAGGGTTTGTGGAGTGACTTGTGTGGTGGTGAAGGCTATGTTTTGCTGTTGATACTAAAGAGAAATGATAAAGAAGAACTGAGATAAGGACAGGAAATGTTATAGAGAGAGCCATTCAAAGACAAGTTATGGATCCTTTGTCTTAAGTGTGGTGGATTTATATATAAAGACAATAAGTTTGGTCTTTGGTGCAACGATTACAGAGGATGAATCAGGTAGTGGTATAAGATCAAGGAAAAGGACTTAACTCCTTACTTGTAGCTGTCTGGAGTGGTTTGAAGTGGGATTTGAGACTGACACATTTGAAGACCAAATCTTAGTGTTGGACTTAGATCACTCATTCGCTTACAACCCAAGGAAACCGAATCTGAATTATACAAACTTTCGCATAACCATACATTTAAAGTTCTTTTGATCTCTCAGCTTATGTTGACTTTTTAACTGATAATATTCACTAAAACTGTTTTAACTACAAAAAACATAAACATGGTATTGGTTTTCTTTGT


Protein sequences

Name Description Sequence
At.69694 translated coding region predicted by ESTScan from UniGene At.69694

MALSITFPVLISVLLYHFSLVSTAKHSLHHHTSHSTNPKQHLQQAYRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSNPNTLVVAGIDLNHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNVTVSYNYFSEEEGICRNLTSRGIAIDDRYNCLPDKPLQRPQKVCDAVLEHPIDCYDHECSPMAPLVAPSTAGPSIAPGPADT

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
39-350 SSF52058,LRR

KQHLQQAYRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSNPNTLVVAGIDLNHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNVTVSYNYFSEEEGICRNLTSRGIAIDDRYNCLPDKPLQRPQ

Gene3D: G3DSA:3.80.10.10
42-327 G3DSA:3.80.10.10

LQQAYRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSNPNTLVVAGIDLNHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNVTVSYNYFSEEEGICRNL

HMMPanther: PTHR24420:SF665
46-349 PTHR24420:SF665

YRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSNPNTLVVAGIDLNHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNVTVSYNYFSEEEGICRNLTSRGIAIDDRYNCLPDKPLQRP

HMMPanther: PTHR24420
46-349 PTHR24420,FAMILY NOT NAMED

YRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSNPNTLVVAGIDLNHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVFANNDFSGCLPPTIARFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLEQLNLEHNMFTGTVPLGVCVLPSLLNVTVSYNYFSEEEGICRNLTSRGIAIDDRYNCLPDKPLQRP

HMMPfam: PF13855
116-173 LRR_8,Leucine rich repeat

LALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSLKYLDLRYNE

HMMPfam: PF13855
235-292 LRR_8,Leucine rich repeat

LEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPYSLAGLGHLEQLNLEHNM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox