PRGDB00067016 (At.70106)

From PRG Wiki
Jump to: navigation, search
At.70106
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79583692 (NM_148606)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ATP binding

DNA Sequence

CGTGTGCTTATCCAAAGACGACGAGAGGAGTCCCAAGAAGTCTAGCGGTATCAATCAAATCTCTTCTTACTAGAGGAGATTCCTTGGAACCATCAAGAGGAAGCATTATGGCTGGGGAACTTATTTCGTTTGGTATACAAAACCTGTGGAACCTACTGAGTCAAGAATGCGAGCTATTTCAGGGAGTCGAAGATCAAGTAACTGAACTAAAAAGGGATCTAAACTTGTTAAGCTCTTTTCTGAAAGATGCAGATGCAAAGAAACATACAAGTGCGGTGGTGAAAAACTGTGTTGAAGAGATCAAGGAAATTATCTATGATGGAGAGGATACAATCGAAACATTTGTTCTTGAGCAAAACCTGGGAAAAACAAGTGGTATCAAGAAGAGTATCAGAAGACTTGCTTGCATTATTCCAGATCGAAGGAGATATGCATTAGGTATCGGAGGCTTAAGTAATAGGATCTCCAAGGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGGTATAAGCAACCTCAAGGTGATAAACAAAGGGAGATGCGACCAAGATTTTCTAAGGACGACGATAGCGATTTTGTGGGGTTGGAAGCAAATGTTAAGAAATTGGTTGGATATTTGGTGGACGAAGCAAACGTTCAAGTGGTTTCCATAACCGGGATGGGTGGTCTAGGTAAAACCACACTTGCTAAACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATGGGCTCTCATGGGTGTGTGTTTCACAAGATTTTACCCGAATGAATGTATGGCAAAAGATCTTGAGGGACCTCAAACCCAAAGAGGAAGAAAAGAAAATCATGGAGATGACACAAGATACACTCCAAGGTGAACTAATTCGATTGTTGGAAACGTCTAAGTCATTAATTGTCCTCGATGACATATGGGAAAAAGAAGATTGGGAACTAATCAAGCCAATATTTCCACCGACCAAAGGTTGGAAAGTGTTGCTTACTTCTCGAAACGAGAGTGTCGCCATGCGTAGAAATACATCATATATCAACTTTAAACCAGAATGCCTAACCACTGAAGACAGTTGGACACTTTTTCAGAGGATAGCCCTTCCTATGAAAGATGCAGCTGAATTTAAGATTGATGAGGAAAAGGAAGAGTTGGGTAAGCTAATGATCAAACACTGTGGAGGGTTACCATTGGCCATCAGAGTGTTAGGAGGTATGTTAGCTGAAAAATACACATCGCATGATTGGAGAAGATTATCTGAGAATATTGGATCTCATCTCGTGGGAGGAAGAACTAACTTTAATGACGACAACAACAATACATGTAACTATGTATTGTCTCTAAGCTTTGAAGAATTGCCAAGTTATTTGAAGCATTGTTTCCTCTACTTGGCCCATTTTCCAGATGATTATGAGATAAACGTAAAGAATTTGTCATATTACTGGGCTGCAGAAGGAATATTCCAACCTAGGCATTACGATGGAGAAATCATTCGAGATGTTGGAGATGTCTACATAGAGGAGCTGGTGAGGAGGAATATGGTCATTTCCGAAAGAGATGTAAAGACTTCGAGATTTGAAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCCAAAGAAGAGAACTTCCTACAGATTACCAGTAGCCGCACTTCAACTGGAAACTCTCTGTCTATTGTCACATCTCGCAGGCTTGTCTACCAATATCCTATTACATTAGATGTTGAGAAAGATATAAACGATCCAAAACTTCGATCTCTCGTGGTTGTTGCCAATACTTATATGTTTTGGGGAGGTTGGAGTTGGATGCTGTTAGGTTCAAGCTTTATAAGGTTAGAACTACTGAGGGTATTAGATATCCATAGAGCCAAGTTGAAAGGAGGGAAGTTAGCTTCTTCCATTGGACAGCTCATCCACTTAAGATACTTGAACTTAAAGCATGCTGAGGTAACTCATATACCTTATTCACTAGGAAATCTGAAGTTGTTGATCTATCTGAATTTAGTCATTTTAGTCTCCGGATCTACATTGGTGCCCAATGTCTTGAAGGAGATGCAACAACTGAGATACCTTGCGTTACCAAAAGATATGGGGAGGAAGACAAAACTAGAATTGAGTAATCTAGTAAAATTGGAGACTTTGAAAAATTTCTCAACAAAGAATTGCAGCTTGGAGGATCTTCGTGGTATGGTCAGGCTGAGAACGCTCACCATCGAATTACGTAAGGAGACGAGTCTAGAAACTCTAGCTGCATCTATAGGCGGATTGAAATACCTCGAAAGCCTTACAATAACTGATCTTGGTTCTGAGATGAGGACGAAGGAAGCGGGAATCGTATTTGATTTCGTTTATCTCAAAACGCTAACGTTGAAACTGTATATGCCTAGGCTTTCTAAAGAACAACACTTCCCTTCTCACCTTACAACCTTATATCTACAACATTGTCGGTTGGAAGAGGATCCCATGCCGATTCTAGAGAAGTTGCATCAGTTGAAAGAGCTTGAATTAAGGCGTAAATCTTTCAGTGGAAAGGAAATGGTTTGCTCGAGCGGTGGGTTTCCTCAATTGCAGAAGCTTTCAATAAAAGGACTAGAGGAATGGGAAGATTGGAAAGTAGAAGAAAGCTCCATGCCAGTTCTTCATACTCTCGATATTCGGGATTGTCGAAAATTAAAGCAGCTTCCTGATGAACACCTTCCTTCTCACCTTACATCCATATCTCTATTTTTTTGTTGTTTGGAGGAGGATCCAATGCCGACTCTAGAGAGATTGGTTCACTTGAAAGAGCTTCAATTATTGTTTAGATCTTTCAGTGGGAGGATAATGGTTTGCGCTGGCAGTGGGTTTCCTCAACTGCACAAGCTAAAATTATCTGAACTAGATGGGTTGGAAGAGTGGATAGTAGAGGATGGCTCCATGCCACAGCTTCATACTCTGGAAATTCGTCGGTGTCCAAAGTTAAAGAAGCTTCCTAATGGGTTTCCACAATTGCAGAATCTTGAGTTAAATGAGCTAGAGGAATGGGAAGAGTGGATAGTAGAGGATGGCTCCATGCCACTTCTTCATACTCTAAGAATTTGGAATTGTCCAAAGTTAAAGCAGCTGCCTGATGGGTTGCGATTTATCTATTCATTAAAGAATTTGACTGTACCAAAGAGATGGAAGAAGAGATTGTCGAAAGGAGGAGAAGATTATTACAAAGTCCAACACATTCCTTCTGTTGAATTCTACTAGGAATGCTCTCAGCAATCACAGACTATGTATATATATGTACACATAAAGAGCTGCATTGATGGTGTTCGATGAATTGTCTAACTGTGACTATCCTTGACGAGATATGTAATCATAAGCCTCTGTTTCCACCCAAAATCAGGTCGGAAGATAGTTGCAGGTAGGAAGCTAATCAAACAAGACACCTTATTTTTCACGACGAGATGTTGAACCCCTGAAGAATGTTGGACACCATTTTGATGGATAAAACATTTTCATAGGAGAAATGATACTTTATGGGAGTGTTGCGGCGAAGCTACTGAACCTTTTTGAAAGCGGTGTTGCCTATCTTTAAGAGCGTCGGAGGTGATATAACTGGGAGACTCTTGATGAGATGTTGGCCTATCTGGAATACTTCCCAGTTGGGAGACCAACGGAGATGAATACCGTCAACAATTCACCAACGACCCATCTCAAGAGCTTGGACACGAGGGAGAAGGTTGGTGCCTGGTTCAAACAGTGGTGCATCCAAAACGCAGGCCGTGTAGCATTTTGTTTCGGGTTCTACATGGCCATGGCGAAGAAGGGTGACCAGTTGGAAGGTGCATACACCCTAAATACTATAAAGGTTTATAGAAGTGATTGATTTATTCCATTCAACGATTTACAATATATATACACAAGAGAGACTTGCTGAGCACACTTATAATCAATGTGAGTATATACAATATTAC


Protein sequences

Name Description Sequence
At.70106 translated coding region predicted by ESTScan from UniGene At.70106

XCAYPKTTRGVPRSLAVSIKSLLTRGDSLEPSRGSIMAGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNLLSSFLKDADAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKLKQLPDGLRFIYSLKNLTVPKRWKKRLSKGGEDYYKVQHIPSVEFY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
47-1040 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QNLWNLLSQECELFQGVEDQVTELKRDLNLLSSFLKDADAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKL

HMMPanther: PTHR11017:SF125
47-1040 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

QNLWNLLSQECELFQGVEDQVTELKRDLNLLSSFLKDADAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRHYDGEIIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKL

superfamily: SSF52540
182-432 P-loop containing nucleoside triphosphate hydrolases

DKQREMRPRFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVG

Gene3D: G3DSA:3.40.50.300
203-339 no description

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNE

HMMPfam: PF00931
IPR002182
203-495 NB-ARC,NBS
NB-ARC

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNYVLSLSFEELPSYLKHCFLYLAHFPDDYEINVKNLSYYWAAEGIFQPRH

FPrintScan: PR00364
IPR000767
221-236 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

Seg: seg
275-286 seg

KPKEEEKKIMEM

FPrintScan: PR00364
IPR000767
298-312 DISEASERSIST
Disease resistance protein

LLETSKSLIVLDDIW

Coil: coil
374-395 coiled-coil

KDAAEFKIDEEKEELGKLMIKH

FPrintScan: PR00364
IPR000767
396-410 DISEASERSIST
Disease resistance protein

CGGLPLAIRVLGGML

Seg: seg
435-446 seg

TNFNDDNNNTCN

superfamily: SSF52058
533-871 L domain-like,LRR

HLHDMMREVCLLKAKEENFLQITSSRTSTGNSLSIVTSRRLVYQYPITLDVEKDINDPKLRSLVVVANTYMFWGGWSWMLLGSSFIRLELLRVLDIHRAKLKGGKLASSIGQLIHLRYLNLKHAEVTHIPYSLGNLKLLIYLNLVILVSGSTLVPNVLKEMQQLRYLALPKDMGRKTKLELSNLVKLETLKNFSTKNCSLEDLRGMVRLRTLTIELRKETSLETLAASIGGLKYLESLTITDLGSEMRTKEAGIVFDFVYLKTLTLKLYMPRLSKEQHFPSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKG

Seg: seg
663-681 seg

YSLGNLKLLIYLNLVILVS

superfamily: SSF52047
812-1057 RNI-like,LRR

PSHLTTLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRDCRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKLKQLPDGLRFIYSLKNLT

Gene3D: G3DSA:3.80.10.10
817-895 no description

TLYLQHCRLEEDPMPILEKLHQLKELELRRKSFSGKEMVCSSGGFPQLQKLSIKGLEEWEDWKVEESSMPVLHTLDIRD

Seg: seg
833-847 seg

LEKLHQLKELELRRK

FPrintScan: PR00364
IPR000767
883-899 DISEASERSIST
Disease resistance protein

SSMPVLHTLDIRDCRKL

Gene3D: G3DSA:3.80.10.10
896-1057 no description

CRKLKQLPDEHLPSHLTSISLFFCCLEEDPMPTLERLVHLKELQLLFRSFSGRIMVCAGSGFPQLHKLKLSELDGLEEWIVEDGSMPQLHTLEIRRCPKLKKLPNGFPQLQNLELNELEEWEEWIVEDGSMPLLHTLRIWNCPKLKQLPDGLRFIYSLKNLT

Seg: seg
1004-1019 seg

QLQNLELNELEEWEEW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox